Developing Rice as a Model for Cereal Genomics

Stephen A. Goff

Torrey Mesa Research Institute, Syngenta, 3115 Merryfield Row, San Diego, CA 92121, USA; Stephen.goff@syngenta.com

Cereals constitute between 60 and 70% of worldwide crop production, and rice, wheat, and maize are the three most important cereals. More than 500 million tons of each is produced annually worldwide. Approximately one third of the population depends on rice for over 50% of their caloric intake, and half of the population derive a significant proportion of their total calories from rice. The cereals have been evolving independently from a common ancestral species for 50-70 million years, but despite this long period of independent evolution, cereal genes and genomes display relatively high conservation. Comparisons of the physical as well as the genetic maps of the grass genomes have led to numerous reports describing conservation of gene order and orientation, or synteny, among the cereals. Due to the high degree of synteny, the grasses, including cereals, are often considered as a single genetic system. Despite the gene similarity and genome synteny, cereal genome sizes vary considerably. Rice has a much smaller genome size than the other major cereals, estimated at 420 Mbp, while sorghum, maize, barley, and wheat have genomes of 1,000, 3,000, 5,000, and 16,000 Mbp respectively. The genome size and predicted higher gene density of rice make it an attractive target for cereal gene discovery by genome sequencing.

Over the past several years, selected regions of the rice genome have been sequenced, and an international project (IRGSP) to generate a highly accurate completed sequence was established. In this report we describe the use of random fragment shotgun sequencing to discover rice genes, molecular markers, and mapped sequences for the association of candidate genes and the traits they control. The genome of rice was sequenced to over 6-fold coverage by a draft sequencing approach and assembled. The accumulated sequence represents more than 99% of the rice genome, and contains over 99% of the publicly available full-length rice protein sequences. Over 42,000 genes or gene fragments longer than 500 base pairs and 63,000 genes or gene fragments longer than 300 base pairs were predicted using an integrated gene prediction, sequence homology, and protein domain/motif identification strategy. More than 85% of the predicted Arabidopsis genes display significant homology to genes predicted in rice, and approximately one-third appear to be plant-specific. Greater than 98% of the publicly available proteins of maize, wheat, and barley were found with significant homology in the draft sequence assembly and more than 95% of translated cDNAs were found in the rice draft gene predictions. Approximately 40,000 simple-sequence repeats (microsatellites) were identified in the draft genome sequence. Synteny between the rice genome and other cereal genomes was found to be significant, whereas synteny between rice and Arabidopsis is restricted to short regions of the genome carrying 5 to 15% of the genes. No evidence for lateral DNA transfer was found in a comparative analysis of the rice and human genomes. The Syngenta draft sequence of rice provides a solid foundation for completing a high-accuracy sequence, enabling gene identification, facilitating physical and genetic mapping, and serving as a syntenic model for the other major cereal crops: maize, wheat, and barley. Details of the sequencing and analysis will be presented.

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

TBA

Huada

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Sequence Analysis of the Rice Chromosome 4

Bin Han

National Gene Research Center, CAS

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Sequencing Rice Chromsomes 10 and 3

Rod Wing

Professor and Director, Arizona Genomics Institute, Department of Plant Sciences, University of

Arizona, 303 Forbes Building, Tucson, AZ 85721, USA

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Regulation of Plant Development by Photoreceptors

Chentao Lin

Department of Molecular, Cell and Developmental Biology, University of California, Los Angeles, 621 Charles Young Drive South, Los Angeles, CA 90095-1606, USA

Plants undergo developmental changes in response to light, which, referred to as photomorphogenesis, is largely mediated by the two classes of photosensory receptors, red/far red light receptors phytochromes and blue/UV-A light receptors cryptochromes. Arabidopsis has five phytochromes, phyA-phyE, and two cryptochromes, cry1 and cry2. These photoreceptors act concurrently in regulating stem elongation, leaf expansion, photoperiodic flowering,, and changes in gene expression. To understand how photoreceptors regulate these light responses and the molecular mechanism underlying photoreceptor signal transduction, we have taken both conventional molecular genetics approach and bioinformatics approach. We analyzed how different photoreceptors work together to regulate photoperiodic flowering. Our results demonstrated that both phytochromes and cryptochromes act as photoperiod sensors by alternating cellular levels of the photoreceptors. We have also investigated the initial photochemistry of cryptochromes and found that cryptochromes undergo blue light dependent phosphorylation. We demonstrated that the blue light-induced cryptochrome phosphorylation is associated with the function and regulation of the photoreceptors. Finally, we will discuss new light signaling genes identified using the bioinformatics approach.

¡¡

An Estimation of the Minimum Number of SSR Alleles Needed to Reveal Genetic Relationships in Wheat Varieties. I. Information from Large-scale Planted Varieties and Cornerstone Breeding Parents in Chinese Wheat Improvement and Production

XY Zhang*, CW Li, LF Wang, HM Wang, GX You, YS Dong

Key Lab of Crop Germplasm & Biotechnology ICGR, CAAS, Beijing China 100081

*Corresponding author, E-mail: xueyongz@public.bta.net.cn; Tel: 010-62186630, Fax: 010-62186629

The genetic relationships of 43 wheat varieties were analyzed with SSR markers. The materials used included 14 cornerstone breeding parents used before 1980 and another 29 other large-scale planted varieties currently in use in China. A total of 501 different alleles were amplified, including 166 alleles of the A genome, 174 of the B genome and 161 of the D genome. Data obtained were used to estimate genetic similarity using the DICE coefficient, and dendrograms were constructed using the UPGMA method. The dendrogram with 501 alleles successfully differentiated all the cornerstone breeding parents and the large-scale planted varieties, and the dendogram tree was basically consistent with the pedigrees of these varieties. The correlation coefficient between the genetic distance matrix of 501 alleles and that of 450 was 0.99. Correlation coefficients among random samples of alleles suggested that 350 to 400 alleles were needed to detect genetic relationships among common wheat varieties. Correlation coefficients of a genetic similarity matrix based on 580 and those of 501 and 400 random alleles were 0.96 and 0.94, respectively. However, there were marked differences between the matrix based on the 501 alleles and those based on markers located on A-, B- or D-genome independently. The correlation coefficients between the genetic distance matrix of 501 alleles and alleles within A, B or D genomes were 0.77, 0.76, and 0.67. The estimation of genetic similarity should be based on data from all genomes rather than any one genome.

Key words: Wheat; SSR; Genetic relationships; Genetic diversity

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Genetic Diversity and Phylogenetic Analysis of Almond Germplasm Using EST-SSRs

Yong Xu, Rong-Cai Ma*, Ming-Qing Cao

Beijing Agro-Biotechnology Research Center, Beijing, 100089, P. R.China; *Corresponding author; e-mail: rcma1@yahoo.com, Tel: 86-10-51503831/2, Fax: 86-10-51503980

Almond comprises at least 26 species that form a distinct and easily recognized natural group in the world. It originated in Central and Western Asia and then extended to China, India, and Mediterranean region. Sweet almond (A. communis L. var. dulcis syn. Prunus dulcis Mill.) is one of the most important fruit nuts in the world.

EST-SSR is the simple sequence repeat derived from EST sequence. It occurs in transcribed region and stands for the functional gene, so they are valuable in comparative genetic analysis, mark¡ªassistant breeding, and germplasm assessment.

From more than one thousand ESTs (857 from private database and 200 from public database) of almond and peach, 58 SSRs were screened and 26 SSR primer sets designed. Fifteen of the SSR primer sets produced easily identified products in 43 accessions of five almond species, Amygdalus communis L., A. mongolica (Maxim) Y¨¹, A. ledebourianan Schleche, A. tangutica (Batal.) Korsh., and A. triloba (Lindl) Ricker, and 2 accessions of peach (A. persica L.) which were used as an outgroup. This cross-species transferability allowed us to construct the phylogenetic tree and the result was consistent with traditional classification. Some species-specific alleles were distinguished and they were successfully used to identify two hybrids between species in our studies.

These SSRs were also used to investigate the genetic diversity of common almond (Amygdalus communis L. var. dulcis syn. Prunus dulcis Mill.) germplasm in the world, including 20 native cultivars of China and 17 currently cultivated in Australia, USA and European countries. Number of alleles detected ranged from 1 to 11 in the 37 accessions (mean 3.0 alleles) and heterozygosity (He) ranged from 0 to 0.809 (mean 0.405). The cluster analysis showed that Chinese and other almond were classified into two independent groups, which is consistent with their geographic origin. These two groups were differentiated by some specific alleles, strongly suggesting that geographic isolation or founder effect contribute to the evolution of these specific alleles.

Genomic SSRs were further compared with the EST-SSRs in the present study. Using the 7 genomic SSR primer sets, thirty-seven alleles were detected with an average 5.4 alleles per locus in Chinese accessions and 39 alleles with an average 5.6 alleles per locus in others. The number of alleles detected per locus was significantly (P<0.01) different from that of EST-SSRs.

Up to our knowledge, this is the first report on the EST-derived SSR analysis of almond. The significance of this work in almond breeding and the conservation and evaluation of almond genetic resources was discussed.

Key words: almond; Amygdalus communis L.; expressed sequence tags (ESTs); SSR

Acknowledgement: This work was financially supported by the National Natural Science Foundation of China (grant No. 30170649) and the National Tenth Five-Year Program of Science and Techonology (grant No. 2001BA707B02) of China.

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Diversity Comparison and Genetic Relationship between Awarded Soybean Cultivars and their Ancestors in China

Zhang Bo, Qiu Lijuan, and Chang Ruzhen

Key lab of crop germplasm and Biotechnology, Chinese Agriculture Ministry; Institute of Crop Germplasm Resources, Chinese Academy of Agricultural Sciences, Beijing 100081; bozhang@sina.com

More than 1300 soybean cultivars (lines) were obtained from 1923 to 2001 in China, it would valuable to evaluate the genetic diversity and relationship of excellent cultivars and their ancestors. The objective of this study was to analyze the genetic diversity of excellent cultivars and provide instructions for parents selection, genetic differentiation and heterosis forecast. A set of 31 SSR core primers were used to analyze 12 excellent cultivars and their ancestors, and detected 212 alleles with average 6.84 alleles per locus. Average alleles (4.97) and genetic diversity index (PIC and Shannon, 0.73 and 1.29) of cultivars were less than those of ancestors (5.61, 0.74, 1.53). T test indicated that genetic diversity on 31 SSR loci in them reached un significant level. Therefore, genetic base for cultivars were narrower than that for ancestors. The main characteristics of cluster analysis indicated cultivars and ancestors distributed evenly in two groups and those with geographic origin and pedigree were clustered together. This result was as same as reported in the literatures. So less alleles could be used to illustrate genetic relationship of cross related varieties. Correlation analysis of contribution ratio by pedigree and genetic similarity coefficient reached significant level, it is suggested that for parents selection that genetic contribution ratio was needed to be calculated firstly and then genetic similarity coefficient was taken account of between parents in order to reduce task.

Key words: soybean; cultivar; ancestor; SSR; genetic diversity

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Improvement of Shanyou 63, an Elite Hybrid Rice, by Molecular Marker-Aided Selection

He Yuqing*, Jiang Gonghao, Li Shiping, Zhou Penghui, Chen Sheng, Tu Juming, Xu Caiguo and Zhang Qifa

National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China *correspondence author: yqhe@mail.hzau.edu.cn

Shanyou 63, a cross between Zhenshan 97 and Minghui 63, is an elite hybrid widely used in rice production in China. The general characteristics of this hybrid include high yielding and wide adaptability. In recent years, however, this hybrid has shown several major problems in rice production including: the loss of resistance to diseases such as bacterial blight (BB) and fungi blast, in addition to its relatively poor cooking and eating quality. There is also urgent need for improving its resistance to insects such as stem borers and planthopper, as they frequently cause damage to the crop. We have conducted a series of work in order to solve the above problems: (1) Xa21, a wide spectrum BB resistance gene, was introgressed to the restorer Minghui 63 by molecular marker aided selection to improve its resistance to bacterial blight. (2) A Bt d -endotoxin gene, that is toxic to stem borer, was transformed to Minghui 63 to improve the stem borer resistance of this hybrid. (3) Xa21 and the Bt gene were combined into a line under the background of Minghui 63. (4) The allele at the Wx locus from Minghui 63 was transferred to Zhenshan 97 to improve the cooking and eating quality of this hybrid, resulting in a new version Zhenshan 97 with medium amylose content (AC), soft gel consistency (GC) and high gelatinization temperature (GT), indicating significant improvement of the cooking and eating quality. (5) Pi1 and Pi2 were both broad spectrum and highly resistance genes to fungi blast races. These two genes were intergressed to Zhenshan 97 to improve the blast resistance by molecular marker-aided selection. (6) The Bt, Xa21 and wx genes were pyramided in one new hybrid by MAS, and the agronomy traits and the performance of the hybrid are the same as the control Shanyou 63, and the blast resistance genes are further pyramided in this hybrid rice. These results are showing great promise as improved hybrid in rice production.

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

SSR Markers for Fusarium Head Blight Resistance QTLs in Three Wheat Populations

1Lijuan Ren, 1Weizhong Lu, 2Xiaorong Shen and 1Yanghai Xiang

1Instiute of Genetics and Physiology, Jiansu Academy of Agricultural Sciences, Nanjing, China; 2Department of Agronomy, purdue University, West Lafayette, USA

Fusarium head blight (FHB or Scab), caused by Gibberella Zeae, is a widespread disease of cereals causing yield and quality losses and contaminating cereal products with mycotoxins. Development of resistant cultivaes is the method of choice for controlling the disease. But breeding of resistance cultivars has been difficult with traditional method because of the complex inheritance of resistance, confounding environmental effects and few resistant sources. Molecular markers are powerful tools that can be used for marker-assisted select, and molecular markers associated with quantitative trait loci (QTL) have been reported for many crops ang many important traits.

DNA markers linked to genes controlling FHB resistance have been identified and mapped, and may be used to speed the introgression of resistance genes into adapted cultivars. This study was conducted to identified and locate the SSR markers for FHB resistance genes in three wheat recombinant inbred populations. These populations were evaluated for reaction to inoculation with F. graminearum in greenhouse and in field conditions. The first population of 180 recombinant inbred lines was from the cross Sumai3 (resistant)/Alondra (susceptible). Two SSR markers associated with resistant genes, which were located on chromosome 3B, were found. These markers account for 2.6-6.7% phenotypic variation. The second population of 156 recombinant inbred lines was from the cross 894037 (resistant)/Alondra (susceptible).Total of 59 SSR primers were screened on this population. Seven SSR markers linked to resistant genes were found using ANOVA and regression analysis. QTLs on the chromosomes 3B account for 47.4% phenotypic variation. Minor QTLs were also located on 2D, 7A, 6B and 4B chromosomes, and the resistance QTL on 2D and 4B chromosomes. The last population of 94 recombinant inbred lines was from the cross Wangshuibai (resistant)/Alondra (susceptible).Total of 120 SSR primers were screened on this population. Eight SSR markers linked to resistant genes were found using ANOVA and regression analysis. These markers were located on chromosomes 3B, 4B, 2D, 4D and 6D (uncertain) respectively. The resistant genes on chromosomes 4B and 6D(uncertain) are from Alondra. But it is interested that the resistance QTL on chromosome 2D is from Wangshuibai instant of Alondra. We will test it again in the future.

SSR markers linked to resistance genes on chromosome 3B were found in all three populations, and account for higher phenotypic variation. So these markers should be useful in marker-assisted selection.

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Genetic Analysis, Tagging and Mapping of Southern Corn Rust Gene*

CHEN Cui-Xia1,2, YANG Dian-Er1, WANG Zhen-Lin2, JIN De-Min1, WANG Hong-Gang2 and WANG Bin1,¢Ù¢Ù

1 Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China; 2 Agricultural College, Shandong Agricultural University, Taian 271018, China; * * Corresponding author

Southern corn rust (SCR) is a destructive disease in maize. Inoculation tests showed that most of the inbred lines commonly used for corn breeding (such as 478, Dan340, Huang C, Huangzao 4, 9801, Luyuan92, 1145 and 107) are susceptible to SCR. While 178 showed ordinary resistance to SCR. One of the 10 examined inbred lines, Qi319, is highly resistant to SCR. Five F1 hybrids were derived from Qi319 crossed with five susceptible inbred lines (478, Dan340, 9801, luyuan92, Huangzao4 and HuangC) respectively. Five F2 generations were produced by F1 self-pollinated and 5 BC1 generations were obtained by backcrossing F1 with the corresponding susceptible parent. The inheritance of the resistance to SCR in Qi319 was investigated. The P1¡¢P2¡¢F1s¡¢the individuals of the 5 F2 and BC1 populations were inoculated with the SCR pathogen Puccinia polysora Underw, and the phenotypes of resistance were scored up and analyzed. Results showed that all of the F1s were resistant, all of the 5 F2 populations segregated in a ratio of 3R: 1S, and all of the 5 BC1 populations segregated in a ratio of 1R: 1S. Therefore, it is considered that Qi319 carries one dominant gene for resistance to SCR. Then, SSR-BSA (bulk segregant analyses) was carried out, total about 100 SSR primer-pairs evenly distributed throughout the 10 chromosomes were screened. Out of them, two primers on chromosome 10, phi118 and phi041, show linkage relation with SCR resistance. Based on this result, 6 new SSR primer-pairs surrounding the region of primer phi118 and phi041 on chromosome 10 were selected and tested regarding to their linkage with the SCR resistance in an F2 population and a BC1 population from the cross of ¡°Dan340 X Q319¡±. Results pointed that three SSR markers (umc2018, umc1293 and umc1318) were linked to the SCR resistant gene. According to the nomenclature of disease resistant gene, the SCR resistant gene to Puccinia polysora Underw in the inbred line Q319 was named as RppC.

In order to find markers more closely linked to the RppC gene, AFLP-BSA analysis was carried out. Total 64 AFLP primer combinations were analyzed. Results indicated that two AFLP markers, AF1 and AF2 from the amplification products of primer combinations E-AGC/MCAA and E-ACC/MCAT respectively, were linked with the RppC gene with a genetic distance of 3.34 cM and 6.5 cM respectively. The RppC gene was mapped on chromosome 10, it is located between SSR marker umc1318 and AFLP marker AF1 with a genetic distance of 4.46 and 3.34 cM respectively.

Key words: Inbred line; Qi319; Southern corn rust; Resistance gene

* This research was partially supported by NSF project of China (39893350)

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Preliminary Mapping of Gene Concerning Photoperiod-temperature Sensitive Male Sterility in Wheat (Triticum aestivum L.)

Cao Shuanghe1, Liu Dongcheng1, Liu Like2, Guo Xiaoli2, Zhang Aimin1,*

1 The State Key Laboratory of Plant Cell & Chromosome Engineering, Institute of Genetics & Developmental Biology, CAS, Beijing 100101. 2 China Agricultural University, Beijing, 100094; *Author for Correspondence e-mail:amzhang@genetics.ac.cn

The Project was supported by NSFC.

The photoperiod-temperature sensitive genic male sterile (PTSGMS) is an important material for utilization of heterosis. Comparing to the cytoplasmic male sterile, it has significant advantages such as one-line dual-purpose, adequate restoring resource and without abnormal cytoplasm effect. We selected BAU3338, an excellent stable PTSGMS line identified more than 5 years, as the experimental material, the mapping of its PTSGMS genes using molecular markers was conducted, Aiming to improve the understanding of the genetics.

Based on the fertility distributions of four F2 populations using BAU3338 as the female parent, it was indicated that PTSGMS phenotype is control by polygenes, which include main-effect loci and modified loci. The F2 population of BAU3338/9205 was selected as the mapping population and both SSR markers and ISSR markers were employed for the mapping. The polymorphism rates of 400 SSR markers were about 20% and 10% between two parents and between sterile and fertile bulks, respectively. Only two SSR markers, MS2 and MS164 are link to the PTSGMS gene with genetic distance 18.8 cM and 17.6 cM, respectively. A total of 40 ISSR markers are screened to identify polymorphism between two parents and between sterile and fertile bulks, and the polymorphism rates are 40% and 25%. Three ISSR markers, ISSR818, ISSR830 and ISSR880, were fiound to link to PTSGMS and the their genetic distance to PTSGMS are 12.8 cM, 26.7 cM and 14.7 cM. Two loci of photoperiod-temperature sensitive male sterility in BAU3338, ptms1 and ptms2 , were identified by likelihood ratio and the genetic effect of ptms1 is 2~3 times of ptms2 .

Key words: Photoperiod-sensitive male sterility; gene mapping; wheat

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Fine Mapping of Seven Hybrid Sterility Gene Loci (Hsgli) in Cultivated Rice (Oryza sativa L.)

J. Wan1,2,*, T. Imbe2, N. Horisue2, H. Ikehashi2, Jiang Ling1 and Huqu Zhai1

1 State Key Laboratory for crop genetics & germplasm enhancement, Rice Research Institute, Nanjing Agricultural University, Nanjing, 210095, China; 2 National Agriculture Research Center, Tsukuba, 305-8666, Japan; * corresponding author, Tel(Fax): 025-4396516, E-mail: wanjm@njau.edu.cn

The heterosis of F1 hybrid between Indica and Japonica subspecies could be 20~30% more than regular cultivars, but F1 hybrid sterility is a major obstacle to application of heterosis of Indica-Japonica hybrids in rice production.

The hybrid sterility in indica-japonica crosses has been explained by allelic interaction at locus S-5. Indica and Japonica varieties carry S-5i and S-5j alleles, respectively. Some varieties have a neutral allele S-5n.The genotype of S-5i/S-5j ( F1 hybrid ) produces semi-sterile panicles due to partial abortion of female gametes carrying the allele S-5j. While, such abortion does not occur in S-5n/S-5i and S-5n/S-5j genotypes. The donor of S-5n is referred to as wide compatible variety (WCV). This allele has been incorporated into indica or japonica varieties to overcome hybrid sterility in hybrid rice breeding. So far, the S-5n has been proved to be effective in a large number of indica-japonica crosses. Recently, a set of 2000 individual plants from a three-way-cross IR36/Nekken 2//Akihikari was analysed for S5 fine mapping. The results suggested that S5 located on chromosome 6 between marker L1092 and R1954 with the same distances of 0.5cM. On this basis, S5 has been cloned into 20kb-length BAC fragment.

A number of new HSGLi have also been identified by means of RFLP marker.

A locus S-7 was detected on rice chromosome 7 in hybrids between Aus varieties and some Javanica varieties. The results indicated that S11177 and C23600 were located on the opposite sides of S-7 with the distances of 0.2 cM and 1.0 cM respectively.

With RFLP markers, 268 individuals from the backcross of Yeong Pung / Nekken 2//Nekken 2 were analysed for S-8 linkage. The results showed that S-8 locus was located in the vicinities of R2071 and C61277S on chromosome 6 with the distances of 1.2 cM and 0.8 cM respectively.

A locus S-9 was detected in a backcross population of Jaya/Ketan Nangka// Ketan Nangka hybrids with 362 individuals, anchored on short arm of rice chromosome 4 between R2783 and G282 with the distances of 0.5 cM and 0.3 cM respectively.

A locus S-15 was found in the three-way-cross of IR36/Dular//IR2061-628 with 276 individuals, and anchored on rice chromosome 12 between C268 and R1068 with the distances of 0.8 cM and 0.7 cM respectively.

A locus S-16 was identified on Chromosome 1 in the three-way-cross of Fengjingdao/IR36//Ketan Nangka with 212 individuals, and located between V138 and S2139 with the distances of 1.2 cM and 0.5 cM respectively.

Another locus S-17 was identified in three-way-cross of Akihikari/CY85-26//Penuh Baru ¢ò with 92 individuals, located on Chromosome 12 between C751 and C2 with interval of 2.2 cM.

Up to now, seven HSGLi have been identified by RFLP, and the neutral allele S-8n, S-9n, S-15n, S-16n, S-17n were also found in Akihikari, IR36, Ketan Nangka, Bauten, et.al, respectively. Further genetic analysis and cloning of these neutral alleles are being carried out now.

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Fine Mapping of the Ht2 Gene (Helminthosporium turcicum Resistance 2) in Maize

Xiaoyan Yin1, Qinghua Wang1, Jiliang Yang2, Demin Jin2, Fei Wang1, Bin Wang2 and Juren Zhang1

1School of Life Science, Shandong University,Jinan 250100,China

2Institute of Genetics and Developmental Biology,Chinese Academy of Sciences,Beijing 100101,China

Northern corn leaf blight (NCLB), caused by Exserohilum turcicum (Pass.) is one of the serious diseases of maize. The genes Ht1, Ht2, Ht3 and HtN confer resistance to specific physiologic races of the pathogen. At present, hybrid corn of China is usually resistant to race 1, but susceptible to race 2. The epidemic of race 2 can cause serious damage of maize production. With global temperature increasing, the possibility of epidemic of race 2 would increase. Consequently, fine mapping and cloning of the Ht gene, especially the Ht2 gene that confers resistance to race 2, is very important to the maize production of Chinese agriculture.

An F2 population developed from the cross between resistant inbred 77Ht2 and susceptible inbred Huobai was used for fine mapping the Ht2 gene. The F2 population consisting of 899 individuals was inoculated with race 2. The result of inoculation indicated that the segregation ratio of resistant and susceptible plants was about 3:1 in this population. It is concluded that the trait of resistance to E.turcicum was controlled by a pair of genes and the resistant gene was completely dominant in this population. By RFLP assay, the Ht2 gene was located between the RFLP markers UMC89 and BNL2.369 on chromosome 8£¬with a genetic distance of 0.9cM to BNL2.369 and 4.4 cM to UMC89.The results of SSR assay indicated that the Ht2 gene was linked to the SSR markers UMC1202, BNLG1152, UMC1149. Among the SSR markers, the genetic distance between UMC1149 and the Ht2 gene was 7.2cM. By bulked segregant analysis 7 RAPD-amplified products which were probably linked to the Ht2 gene were selected after screening 450 RAPD primers and the single-copy ones were converted to dominant SCAR markers. By linkage analysis, the genetic distance between the SCAR marker (SD-06633) and the Ht2 gene was 0.4 cM.This results can be applied to map-based cloning the Ht2 gene and molecular marker-assisted selection in maize breeding.

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Molecular Tagging of a New Dominant Earliness Gene in Rice*

Xiaojian Deng1,2, Kaida Zhou1, Renduan Li1 and Lihuang Zhu2

1 Rice Research Institute, Sichuan Agricultural University, Wenjiang, Chengdu 611130;

2 Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101); E-mail: dengxj@mail.sc.cninfo.net

It is commonly suggested that earliness is controlled by one or two recessive major genes or minor polygenes in rice, though there have been a few reports on dominant earliness genes. Tsai analyzed a complicated locus Ef-1, and earliness of the original varieties carrying Ef-1 expressed incompletely dominant inheritance. Sato et al identified two partially dominant earliness genes, Ef-x and Ef-y£¬the earliness effects of which were less than that of Ef-1. Ef-1, Ef-x and Ef-y were located on rice chromosome 10, 2 and 6 or 7, respectively, with methods of classical genetics by Sato et al. But there have not been any report on molecular tagging of dominant earliness genes.

In present study,it was found that an early maturing indica TGMS rice line 6442S-7 had completely dominant earliness. F1 progenies from 6442S-7 crossed with thirteen various types of medium- or late-maturing varieties, such as Minghui 63, Taiyin 1, 02428 and Pei¡¯ai 64S, shared the same heading date as 6442S-7 under short day and long day. Significant segregation of heading date was observed in the F2 populations from the crosses between 6442S-7 and each of the three late heading varieties, Minghui 63, Shuhui 881 and Taiyin 1. The segregation ratio of early to late heading plants in the F2 populations fitted the ratio of 15:1. And the segregation ratio in their corresponding B1F1 populations, which were from the crosses between the three late-maturing parents and their F1 plants, fitted the ratio of 3:1. These results suggested that earliness of 6442S-7 was mainly controlled by two dominant major genes.

The near isogenic pools of earliness and lateness were constructed from the F2 population of 6442S-7/Shuhui 881 and the polymorphisms existed in the two pools was screened by AFLP and RAPD techniques. As a result, AFLP marker PT671 and RAPD marker OPI11.557 were found to be linked to one of the dominant earliness genes in 6442S-7. The DNA fragments of PT671 and OPI11.557 were recovered and cloned, respectively. Both fragments were mapped on the terminal region of short arm of rice chromosome 3 by using the double haploid and recombinant inbred populations derived ZYQ/JX17, and their corresponding molecular linkage maps developed by Prof. Zhu et al. Then, the local linkage map of the dominant earliness gene was constructed with RFLP and SSR markers. The results showed that the dominant earliness gene was located between a RFLP marker C515 and a RAPD marker OPI11.557 on the terminal region of short arm of rice chromosome 3, 10.9cM and 1.5cM from C515 and OPI11.557, respectively. The genetic distances from the target gene to two SSR markers, RM22 and RM231, and one AFLP marker, PT671, were 3.0 cM, 6.7 cM and 12.4 cM, respectively. This gene harbored in 6442S-7, being a first identified and mapped major gene controlling dominant earliness, is designated tentatively as Ef-cd(t). In addition, rich polymorphisms of SSR marker RM231 between 6442S-7 and each of twenty-one elite parents of hybrid rice were observed in agarose gel electrophoresis. Therefore, RM231 can be used as a selective marker for Ef-cd(t) gene in marker-assisted selection.

The Ef-cd(t) gene could be utilized for rapid developing early-maturing hybrid rice. On the other hand, the gene could also facilitate overcoming the late maturity problem that occurs in most inter-subspecific hybrids. Therefore, as a new gene resource of dominant earliness, Ef-cd(t) has splendid future in rice improvement.

Key words: Rice; Earliness; Dominant earliness gene; Gene tagging

¡¡

Functional Genomics Approaches to Study Host-virus Interactions

S.P. Dinesh-Kumar

Department of Molecular, Cellular and Developmental Biology,Yale University, New Haven, CT 06520, USA

Plants mount various defense responses to pathogen attack. One such response involves recognition of pathogen-encoded ligands (elicitors) by plant disease resistance (R) gene encoded receptors. This recognition event initiates signaling pathways that lead to hypersensitive response (HR; localized cell death) at the site of pathogen ingress, rapid oxidative burst, cell wall strengthening, protein phosphorylation and activation of various defense response genes. Significant progress in the understanding of host-pathogen interactions has been achieved in the last decade by the cloning of a number of plant R genes from different plant species. The N gene confers resistance to tobacco mosaic virus (TMV) and belongs to the class of R genes that encode a protein with an amino terminal domain similar to the toll-interleukin-1 receptor (TIR), a centrally located nucleotide-binding domain (NB) and a C-terminal with leucine rich repeats (LRR) (TIR-NB-LRR class). The N protein by itself or in a protein complex is hypothesized to specifically recognize a TMV protein and trigger a signal transduction cascade leading to the induction of HR and restriction of virus spread. Another resistance gene RCY1 in Arabidopsis confers resistance to cucumber mosaic virus (CMV) and encodes CC-NB-LRR type of R gene. We will discuss use of virus-induced gene silencing (VIGS) and tri-color based microarry approaches to identify components of N-and RCY1- mediated signal transduction.

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Applying Microarray and Protein-protein Interaction Technologies to Elucidate Transcriptional Regulatory Mechanism in Rice Grain Development

Xun Wang

Director of Functional Genomics, Torrey Mesa Research Institute of Syngenta, 3110 Merryfield Row, San Diego, CA 92130,USA

Although rice genome has been sequenced, understanding functions of each gene in rice genome is still a big challenge. Among many genomic technologies, DNA microarray is a very effective tool to elucidate gene functions. Last year, we designed and fabricated a rice GeneChip with 24,000 genes on a single chip. In one expression profiling experiment, we analyzed 17 samples from various rice grain filling stages. We found carbohydrate; storage protein and fatty acid biosynthetic pathways were coordinately controlled at transcription levels. 269 genes were found coordinately up regulated at transcription levels. Further analysis of their promoter regions, we found that an AACA element was over represented among these genes. In addition, we found over one hundred transcription factors differentially regulated during grain filling. 13 of them are tightly co-regulated with the 269 genes. Most genes in starch biosynthesis pathways were also found being coordinately regulated. These suggested different isozymes were tightly regulated to define final grain composition. To further dissect transcription mechanism during rice grain filling, we developed an in planta protein tagging technology to isolate protein complexes. We plan to apply this technology along with LC-MS to further characterize the 13 transcription factors.

¡¡

¡¡

Mining EST data from major crops

Gao LF, Tang JF, Li Y, Li XP, Zhang Y, Jing RL, Chang XP, and Jia JZ*

Institute of Crop Germplasm Resources, CAAS, Beijing, 100081

Expressed sequence tags (ESTs) are single pass, partially sequencing reads generated from either the 5¡¯-or 3¡¯end of a cDNA clone. The vast body of the ESTs data in the public databases provide an important resource for the comparative and functional genomics studies.

Mining SSR markers from EST data

ESTs are valuable for genetic analysis. Using large quantity of ESTs deposited in international nucleotide sequence databases, types and frequencies of microsatellites are investigated in this study. 63,440 ESTs from rice (14.3 Mb), 83,656 ESTs from maize (20.9 Mb), 71,495 from wheat (21.4 Mb) and 109,183 from soybean (28.8 Mb) are assembled into contigs respectively, and searched for all mono- to penta repeats. The average frequency of microsatellites is one every 11.81kb in rice, 17.42 kb in wheat, decreasing to one every 23.80kb in soybean and 28.32 kb in maize. Trinucleotide repeats dominate in both monocot and dicot plants. The second abundant repeats are hexanucleotides in monocots, but dinucleotides in dicot. Monocytoledonous plants prefer GC-rich microsatellites significantly, particularly in rice. Our findings demonstrate that repeated types are species-specific and microsatellites relevant to functional genes might contribute to gene functional analysis, map construction and marker-assisted selection. More than eighty EST-SSR markers from wheat derived from wheat EST have been mapped on wheat genetic maps.

Mining species-specific genes from EST data

With the availability of rice and Arabidopsis genome sequences, we can now directly investigate the specific genes of agronomic importance in crop species. This study was designed in three steps. First, data preparation. ESTs of wheat (158,921), maize (103,031) and soybean (177,495) were retrieved from public data bases, then assembled into contigs using software CAP3. Subsequently, contigs from wheat (21,079), maize (12,728) and soybean (17,503) were blasted against rice genes (both of BGI and Syngenta) to search for species-specific genes, or at least gene fragments, for large number of contigs used for blast analysis were over 500bp long. E value was set to 0.5 below which less than 23 basepairs were included in sequence alignment. Based on the standard, 53.8% contigs of soybean appeared to be different from rice genes, which might be reasonable since monocot-dicot diverged 200¡À40 Myr ago, and it was confirmed by the report (J Yu et al,2002) that only 50% of rice genes have homologs in Arabidopsis. Our study also indicated that genes were relatively conserved across grasses since they diverged from a common ancestor < 50 million years ago. However, our result could not well complied with the phylogeny reported before (Kellogy, 2001) that relationship of rice and wheat was more closely that that of rice and maize. Thirdly, species-specific gene annotation. Blastx comparison of wheat, maize and soybean contigs versus rice, Arabidopsis and other proteins form GenBank at high E evalue (E> -30). Obviously, proteins such as zein protein, glidian specific to maize and wheat respectively were separated. Retrotransposons, which occurred in intergenic space conventiallly, were found often in maize genes. This confirmed that retrotramsposons were generally more transcriptionally active in maize. On the other hand, unknown functional species-specific genes of the three crops remain for determination when more proteins are deposited in public database.

Keywords: expressed sequence tags, microsatellites, species-specific genes, wheat, rice, maize

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

The Transcriptome of Arabidopsis Thaliana during Seedling Photomorphogenesis

Ligeng MA1, 2*, Lijia QU1, Zhangliang CHEN1, Jinming LI3, Hongyu ZHAO3, Xing Wang DENG1, 2

1Peking-Yale Joint Center of Plant Molecular Genetics and Agrobiotechnology, College of Life Sciences, Peking University, Beijing 100871, P. R. of China,

2Department of Molecular, Cellular, & Developmental Biology, Yale University, New Haven, CT06520-8104, USA

3Department of Epidemiology and Public Health, Yale University School of Medicine, New Haven, Connecticut 06520, USA

An EST based microarray was used to profile genome expression underlining light control of Arabidopsis development. Qualitatively similar gene expression profiles were observed among seedlings grown in different light qualities, including far-red, red, and blue light, which are primarily mediated by phytochrome A, phytochrome B, and the cryptochromes. Further, light-dark transitions also triggered similar differential genome expression profiles. Most light treatments also result in distinct expression profiles in small fractions of genes examined. The similarly regulated genes in all light conditions were estimated to account about one third of the genome, with 3/5 and 2/5 up and down regulated by light respectively. Analysis of those light-regulated genes revealed over 28 cellular pathways that are coordinately regulated by light.Similar gene expression profiles were also observed among wild type seedlings grown in white light and multiple cop1 mutant alleles grown in the dark. Overexpression of a dominant negative acting N-terminus of COP1 protein (N282) in darkness triggered a genome expression profile similar to those by white light and the cop1 mutations. Further, similar but weaker gene expression regulation attributable to HY5 in the light is largely included within those regulated by COP1 in the dark. This genomic study supports the conclusion that COP1 acts as a repressor of photomorphogenesis by controlling the degradation of transcription factors and thus regulating their target gene expression. Thus light controls Arabidopsis development through coordinately regulating metabolic and regulatory pathways, and largely achieves its role by negatively regulate COP1 activity.

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Advances in Understanding Genetic Bases of Heterosis

Qifa Zhang

Huazhong Agricultural University

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

The Manipulation of Carbonhydrate Partitioning via Expression of Pyrophosphatase in Transgenic Rice

Lizhen Si, Chengcai Chu*

Institute of Genetics and Developmental Biology, The Chinese Academy of Sciences. Beijing 100101, PR China. *Corresponding author: ccchu@genetics.ac.cn

In higher plant, metabolism and partitioning of photosynthetically fixed carbon is thought to be fundamentally important for plant growth and crop yield. The primary photosynthetic products are either used to synthesize starch or exported into cytosol for sucrose synthesis. Based on the fact that continuous removal of a product from the reaction equilibrium will favor the flux into desired metabolic pathway, mesophyll-specific promoter rbcS was used to drive the E. coli pyrophosphatase gene in rice and to study its impact on photoassimilates partitioning, carbon metabolism and crop yield. In transgenic rice, the pyrophosphatase activity was increased up to 2-3 times of the wildtype. Plants expressing active PPase show no alteration in growth behavior but a drastic change in photoassimilate partitioning. In mature leaves, the content of the soluble sugars did not change much, but the starch decreased 3-4 times, so that the ratio between soluble sugars and starch was increased by 3-4 times compared to the wildtype. In mature leaves of transgenic plants, UDP-glucose, a major substrate for sucrose biosynthesis, increased sharply revealed indirectly the equilibrium favors to sucrose biosynthesis pathway. Assay with the enzymes involved in sucrose and starch biosynthesis and also glycolysis such as cyFBPase, ADP-glucose phosphorylase, and phosphofructokinase (PFK), indicates that alteration of photoassimilates partitioning promotes the overall carbohydrate biosynthesis and metabolism. The total amino acids and the ratio of Gln/Glu and Asn/Asp increased drastically suggest that the expression of pyrophosphatase changes not only the photoassimilates partitioning but also nitrogen fixation and metabolism. The plant will be a powerful tool in investigating of both primary and secondary metabolism.

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Generation of a Rice Mutant Library by Shotgun Antisense Gene Silencing

Yuanling Chen, Yaoguang Liu, Yuyu Jian

College of Life Science, South China Agricultural University, Guangzhou 510642 , China

Antisense gene silencing has been widely used to study functions of interesting genes. The technology is also useful for generation of mutant libraries by introducing antisense cDNA libraries into cells. We constructed a rice antisense cDNA library using a binary vector modified from pCAMBIA1302. About 1000 random clones from the library were used as a pool to transform a rice variety Zhonghua No.11 by Agrobacterium mediated method.

Totally, 104 hygromycin (Hm) resistant calli were obtained and more than 2000 transformed plantlets were regenerated from these calli. Preliminary screening of transgenic plants was carried out by soaking leaf segments in hygromycin B solution for 7d. Of 558 T0 plants tested, 544 showed Hm resistant and 14 partial resistant to hygromycin B. PCR analysis of 148 Hm resistant plants with primers specific to HPT gene showed that all tested plants were positive. Fragments of antisense cDNA could be amplified from 103 of 108 Hm resistant plants.

Various types of phynotype variations were observed in T0 plants such as: height (10-100 cm), fertility (0-90%), tillering ability (no tiller to more than 40 tillers), shape of grain, heading time, etc. Phynotype variations were also observed among plants regenerated from the same callus. Co-segregations of trait variations with Hm resistance for some mutant lines were observed. For example, a T1 population showed that the pollen fertility was co-segregated with Hm resistance. So we PCR-amplified the antisense cDNA fragment from the transgenic plant using specific primers flanking the vector cloning site, and sequenced the fragment. The sequence BLAST result showed that the amino acid sequence exists a conserved F-box motif. It is reported that F-box proteins are related to ubiquitin-dependent protein degradation, while many crucial biological processes in plants, such as hormone response, circadian rhythm , photomorphogenesis, stress response, flower development and senescence are governed by proteolysis. Further analysis of the mutant library is underway.

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Functional and Comparative Bioinformatic Analysis of 26,085 ESTs from Salicylic Acid-Treated Soybean (Glycine max L.)

Ai-Guo Tian, Jun Wang, Peng Cui, Zong-Ming Guo, Jian Li, Wei Tong, Bang-Jun Wang, Yong-Jun Wang, Jin-Song Zhang, Jun Yu and Shou-Yi Chen

Plant Biotechnology Lab, Institute of Genetics and Developmental Biology, CAS, Beijing 100101, China; Beijing Genomics Institute/Center of Genomics and Bioinformatics, CAS, Beijing 101300, China

Expressed sequence tags (ESTs) were obtained from cDNA libraries that were made from soybean seedlings (Glycine max L., SMV resistant variety Kefeng 1) treated with salicylic acid (2.0 mmol/L). After removal of low-quality and shot sequences (less than 80 bp), 26,085 ESTs were assembled into 2,937 contigs and the rest, 7,536 ESTs, remained as singletons. Included also in our analysis are two other public data collections: (1) the NCBI collection, 527 contigs and 964 singletons assembled from 2,289 soybean ESTs from Gm-c1014 seedling cDNA library and (2) the Washington University collection, 11,969 contigs and 27,146 singletons from an assembly of 120,077 soybean ESTs. In comparison to these public data, 18.91 % of EST collection was novel and 24.79% had homologous sequences (E value 10¨C10) in the GenBank non-redundant nucleotide and the Swiss-Prot protein databases. After classified into 14 functional categories, comparison of ESTs from our collection and from the NCBI collection showed the most significant difference in the proportion of ESTs involved in protein synthesis/processing and primary metabolism. Since salicylic acid plays key roles in signal transduction, disease-resistance, defense response and stress tolerance, we identified sixty candidate genes related to these pathways from our data set. We chose 103 cDNA clones for experimental verification using hybridization-based method. 8 and 4 genes were clearly un-regulated and strongly down-regulated by SA, respectively. We also identified 680 SSR and 823 SNP candidates. An average of GC content in ESTs was analyzed in soybean and Medicago truncatula.

Based on the expression statistics, we estimated that gene count of the soybean genome was about 45,000-50,000 or twice as much as that of Arabidopsis.

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Organization and Function of the Ubiquitin/26S Proteasome Proteolytic Pathway in Plants

Richard D. Vierstra, Brian Downes, Jed Doelling, Adam Durski, Jennifer Gagne, Derek Gingerich Mina Kurepa, Jan Smalle, Allison Thompson, Joseph Walker and Peizhen Yan

Cellular and Molecular Biology Program and the Department of Horticulture,

University of Wisconsin-Madison, Madison, WI 53706 U.S.A.

Selective removal of intracellular proteins plays an integral role in the growth, development, and environmental adaptation of plants. One essential proteolytic pathway targets proteins for degradation by covalently tagging the proteins with one or more ubiquitins, a small highly conserved proteins. These ubiquitinated proteins are then selectively broken down by the 26S proteasome with the concomitant release of free ubiquitins. The complexity of the ubiquitin/26S proteasome pathway is best illustrated by estimates that >10% of plant proteins are targets and by our discovery of over 1300 genes in Arabidopsis thaliana that encode pathway components. Correct substrate recognition is accomplished by: (1) the coordinated action of ubiquitin-protein ligases (or E3s) that ligate ubiquitin to specific proteins; (2) enzymes that remove ubiquitins from various targets (UBPs); and by (3) factors within the 26S proteasome that detect ubiquitinated proteins before degradation. Structural diversity within the E3 families (~700 members in one family alone) is apparent that likely imparts much of this target specificity. To understand this diversity, we are analyzing the functions of various pathway components by reverse genetics, using Arabidopsis as model systems. Knockouts in E3s, UBPs and various 26S proteasome subunits have been generated. Phenotypic analyses show that the ubiquitin/26S proteasome pathway is essential to plants and has important roles in embryogenesis, meristem development, plant growth, hormone signaling, and various stress responses. Recently, six other polypeptides have been discovered that also serve as covalently modifiers of other plant proteins. One appears to have an essential role in nitrogen recycling and another involved in the heat stress response. The complexities of these pathways suggest that protein modification by other polypeptides is a common method of post-translational regulation in plants.

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Recent Progress of the China Functional Genomics Program

Yongbiao Xue1, Jingliu Zhang2, Da Luo2, Jiayang LI1, Yaoguang Liu3, Hongwei Xue2, Kang Chong4, Hai Huang2, Guohua Liang5 and Zhihong Xu6

1Institute of Genetics and Developmental Biology, The Chinese Academy of Sciences, Beijing 100080, China (ybxue@genetics.ac.cn)

2Institute of Plant Physiology and Ecology, The Chinese Academy of Sciences, Shanghai 200032, China

3South China Agricultural University, Guangzhou, Guangdong Provice 510642, China

4Institute of Botany, The Chinese Academy of Science, Beijing 100093, China

5Yanzhou University, Yangzhou, Jiangsu Province 225009, China

6The Chinese Academy of Sciences, Beijing 100864 and Beijing University, Beijing 100871, China

To discover genes essential for agronomic performances of crops the China Rice Functional Genomics Program (CRFGP) was initiated in 1999. The CRFGP was funded by the Ministry of Science and Technology of China through the National Basic Research Initiative and was expected to last for an initial period of five years. The mission of the CRFGP is to generate intellectual property related to functional genes and resources for improved crops as well as to train scientists working in the fields of functional genomics. Twenty research groups from the Chinese Academy of Sciences and several universities were organized to participate in the program, which focuses on the identification of genes related to flowering, plant architecture, fertility, reproduction, metabolic controls and stress responses in rice through a combinatorial approach based on genetics, molecular biology and functional genomics. The CRFGP is divided into a total of six projects: 1, Creation of a rice mutant library; 2, Gene profiling and identification by cDNA-microarray; 2, Development of a highly efficient gene cloning system based TAC (Transformation-competent Artificial Chromosome) vectors; 4, Functional genomics of rice transcriptional factors; 5, Development of a rice functional gene database; and 6, Research and development of transgenic rice lines. Some of the recent progress made by the CRFGP will be presented.

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Functional Genomics of MAPK Signaling Cascades in Plants

Jen Sheen

Department of Molecular Biology, Massachusetts General Hospital/Department of Genetics, Harvard Medical School, Boston, MA 02114, USA

Mitogen-activated protein kinase (MAPK) cascades are evolutionarily conserved signaling modules with essential regulatory functions in eukaryotes, including yeasts, worms, flies, frogs, mammals, and plants. Numerous studies have shown that plant MAPKs are activated by abiotic stresses, pathogens and pathogen-derived elicitors, and plant hormones. The Arabidopsis genome and EST sequencing projects have revealed large gene families encoding MAPKs and their immediate upstream regulators, MAPKKs and MAPKKKs. However, little is known about the constitution of plant MAPK cascades and the specific roles that particular MAPK cascade genes play in particular plant signal transduction pathways. We have developed a comprehensive approach based on genomic information, transient expression assays, and transgenic and genetic analyses to determine the function of all Arabidopsis MAPK cascade genes involved in essential plant signaling pathways. The transient nature of the protoplast systems allows direct functional analysis of plant genes at an unprecedented high throughput rate. The experimental approaches are especially powerful in unraveling the functions of genes that are difficult to tackle by traditional genetic and biochemical approaches due to redundancy, lethality or low levels of expression. The involvement of MAPK cascades in hormonal, stress and innate immune responses will be presented. Since the functions of MAPK cascades in plant signal transduction pathways are likely conserved, our studies using the Arabidopsis genome resources will have broad implications and applications in other plant species. The elucidation and manipulation of MAPK cascades in plants has revealed fundamentally important intracellular signaling processes and provided new tools for crop improvement in stress tolerance, disease resistance, and yield enhancement.

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Control of Tillering in Rice

Jiayang Li

Institute of Genetics and Developmental Biology, The Chinese Academy of Sciences, Beijing 100080, China

Plant shoot architecture is determined mainly by the formation pattern and growth habits of ateral shoots. Rice later shoots (tillers) are formed from axillary meristems that locate between a leaf and the shoot axis. Axillary meristems are developed from cells at the base of the subtending leaf, or from cells in the shoot axis just above the subtending leaf. To understand the rice tillering, we isolated and characterized a naturally occurred rice mutant, mon culm 1 (moc1). Compared to wild-type rice plants that normally have more than ten tillers, the moc1 mutant show no tillers due o lacking the axillary buds. MOC1 gene was cloned by a map-based approach. Sequence homology analysis indicates that it encodes a putative transcription factor, which is supported by the finding that MOC1-GFP fusion protein is a nuclear-localized protein. RNA in situ hybridization demonstrates that MOC1 is mainly expressed in the cells at the leaf axil where axillary buds will initiate. Transgenic rice plants that overexpress MOC1 are able to develop more than one tiller at a single axil, in contrast to a single tiller in the wild-type plants. We also found that the expression of OSH1, a rice homolog of maize Knotted1, requires the normal function of MOC1. Therefore, MOC1 may play a critical role in the formation of tiller buds by promoting the initiation of axillary meristems.

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Cloning Sd-1, the Semidwarfing Gene in Rice Using Public Rice Genome Sequence

Wolfgang Spielmeyer, Marc H. Ellis, and Peter M. Chandler

CSIRO Plant Industry, GPO Box 1600, Canberra ACT 2601, Australia

Corresponding author: Wolfgang Spielmeyer, CSIRO Plant Industry, GPO Box 1600, Canberra ACT 2601, Australia. Ph. 61 2 62464934, Fax 61 2 62465000, Email wolfgang.spielmeyer@csiro.au

The semidwarfing gene in rice (sd-1) is one of the most important genes deployed in modern rice breeding, since it led to record yield increases in the 1960s and remains the predominant semidwarfing gene present in current rice cultivars. The phenotype of sd-1 is consistent with dwarfism resulting from a deficiency in gibberellin (GA) plant growth hormones and a partial block in GA biosynthesis. Recently, a GA 20-oxidase gene (Os20ox2) was isolated from the Sd-1 locus in three separate studies by using 1. map-based cloning, 2. degenerate PCR and 3. public rice genome sequence. Altered Os20ox2 gene sequences isolated from several independent mutants were shown to encode the sd-1 semidwarfing locus. The quantification of GAs in elongating stems by GC-MS showed that the initial substrate of GA 20-oxidase activity (GA53) accumulated, while the content of the major product (GA20), and of bioactive GA1, was lower in semidwarf compared to tall lines. Different gene isolation approaches are discussed in the context of rapid progress made in rice genome sequencing. Using the Os20ox2 sequence we also describe the development of ¡®perfect markers¡¯ for two different sd-1 alleles.

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Identification of a 47 Kb DNA Fragment Containing Xa4, a Locus for Bacterial Blight Resistance in Rice

Xinli Sun, Yinglong Cao, Zhifen Yang, Shiping Wang and Qifa Zhang

National Key Laboratory of Crop Genetic Improvement, National Center of Crop Molecular Breeding, Huazhong Agricultural University, Wuhan 430070

Bacterial blight caused by Xanthomonas oryzae pv. oryzae is a devastating disease in rice worldwide. The resistance gene Xa4 has been widely used in breeding programs and played an important role in protecting rice from this disease. Using 642 highly susceptible individuals and a random sample of 255 individuals from an F2 population developed from a cross between IRBB4 and IR24, the Xa4 gene was genetically mapped to a region less than 1 cM. A contig map was constructed for the Xa4 region consisting of six non-redundant bacterial artificial chromosome (BAC) clones and spanning approximately 500 kb in length. Analysis of recombination events in the Xa4 region located the gene locus to one BAC, 3H8. Assay of the recombinants using the subclones of 3H8 in combination with sequence analysis further narrowed the Xa4 locus down to a 47 kb fragment. Candidate genes have been identified from this fragment which have been transformed into the rice cultivar Mudanjiang No. 8, resulting in a more than 100 transgenic plants. Preliminary tests by inoculation with the Xoo strain showed that several of the transgenic plants may be resistant to the strains tested. Further analysis is still in progress.

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

OsRAA1, a Novel Gene Induced by Auxin, is Involved in Establishment of the Root Architecture in Oryza sativa

Kang Chong, Lei Ge, Hui Chen, Yuan Zhao, Ming-Li Xu, Yun-Yuan Xu and Zhi-Hong Xu*

Key Laboratory of Photosynthesis and Environmental Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, Beijing 100093, P. R. China

*Authors for correspondence (e-mail: chongk@ns.ibcas.ac.cn, zhxu@cashq.ac.cn)

The Oryza sativa Root Architecture Associated 1 (OsRAA1) gene, has been characterized molecularly. OsRAA1 shows tissue specific expression in the shoot apical meristem, the elongation zone of root tip, steles of the branch zone and the young lateral root. OsRAA1 - encodes a 12.0 kDa protein that has 58% homology to the AtFPF1 in Arabidopsis. Constitutive expression of OsRAA1 under the control of maize ubiquitin promoter resulted in phenotypes of reduced growth of primary root, increased number of adventitious roots and helix primary root in rice, which are similar to the phenotypes of the plant treated with auxin. OsRAA1 constitutive expression also caused longer leaves and sterile florets at the last stage of plant development. The transgenic plants have longer flag leaf cells than the wild type control. Northen blot analyses demonstrated that the OsRAA1 expression was induced by auxin. These data suggested that OsRAA1 might be involved in the pathway of Auxin/IAA signal transduction in establishing the root architecture in rice.

Key words: OsRAA1; auxin; Oryza sativa; root development

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

The FER Gene of Tomato Encodes a Transcriptional Factor Protein Controlling of Iron Uptake in Roots

Hong-Qing Ling

The State Key Laboratory of Plant Cell and Chromosome Engineering, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Andingmenwai, Datun Road 917 Building, Beijing 100101, China

Iron is an essential mineral element of all organisms. In plants, iron deficiency is the most common nutritional limitation for growth because iron is almost exclusively present in its oxidized, low-soluble form Fe (III) which is not readily available to plants in soil. There are two efficient mechanisms to acquire iron from soil in higher plants (strategy I and strategy II). Characteristics of strategy I (all higher plants except the Gramineae) include increased solubilization of Fe3+ by extrusion of protons and organic acids from plant roots into the rhizosphere, chelation of Fe3+ with organic acids, reduction of the chelated Fe3+ to soluble Fe2+ at the root surface and subsequent transport of Fe2+ in the plant as well as morphological changes of roots, such as thickening of the subapical root zone, formation of root hairs and so on. The efficient iron uptake processes of strategy I are induced upon iron starvation.

In tomato, the iron-inefficient mutant T3238fer, which was originally identified from the boron-inefficient T3238 tomato, is a very informative mutant for study of molecular mechanism of strategy I. The mutant plants are not able to switch on the efficient iron uptake process of the strategy I upon iron-deficiency. Seedlings of the mutant exhibit severe chlorosis and die at an early stage unless they are supplied with Fe or grafted onto a wild-type rootstock (Brown et al., 1971). It was supposed that the FER gene might be a central regulatory gene controlling the whole iron deficiency responses and iron uptake in roots of the strategy I plants. Genetic analysis showed that the T3238fer is a monogenic, recessive trait located on chromosome 6 of tomato (Ling et al., 1996). To study the molecular regulation mechanism of iron uptake of strategy I plants, we have recently isolated the FER gene from tomato genome using map-based gene cloning approaches. The FER gene encodes a transcriptional regulator controlling iron uptake in roots of tomato. The further studying of this gene will give new insights into the understanding of the molecular regulation of the iron uptake mechanism of strategy I plants and form the basis for the manipulation of plants to generate high-yielding, iron-efficient or iron-rich crops to contribute towards the improvement of iron deficiency in humans which afflicts more than two thirds of the world population. Here, I will present the isolation and characterization of the FER gene.

References:

Brown J, Chaney RL and Ambler JE (1971) A new tomato mutant inefficient in the transport of iron. Physiol. Plant. 25: 48-53

Ling HQ, Pich A, Scholz G and Ganal MW (1996) Genetic analysis of two tomato mutants affected in the regulation of iron metabolism. Mol. Gen. Genet. 252: 87-92

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Separation and Selection of Induced Mutants in Rice*

ZHU Xudong1), CHEN Hongqi1), LUO Da2), ZHANG Jianjun3) and MIN Shaokai1)

1) Key Lab for Rice Biology, Ministry of Agriculture, China, CNRRI, Hangzhou 310006

2) Institute of Physiology and Ecology, CAS, Shanghai 200032

3) Institute of Crop Science, SAAS, Shanghai 201106

Groundwork of functional genomics (FG) is based on making create and use of the hereditary mutation. A great number of spontaneous and induced mutants in rice have been accumulated under work of classic genetics, but disperse in the different background. So, the key for research of rice FG is to choose a few of suitable genotype and induce saturated mutants in the whole life. This research reports compendiously the mutants of separation and selection from ¡°Zhong-hua 11" (Oryza sativa L. japonica) 1000 g dry seeds induced by ¦Ã-ray (60Co) measured 300 and 350 Gy.

In generation of M1, there are 38% and 13% of seedling rate under 300 and 350 Gy while the origin with normally 75%, as well as 7510 and 2490 families to have been harvested respectively. Main visible injury on M1 was physiologically semi-sterility or sterility. The variation of seed set was continuous seed set from zero to normal.

All 10000 families of M2 were sowed. Some of them were no germination or germination but no seedlings for low seed set of 5%, or died at about 8% of no chlorophyll formation for albino or chlorina. Only 8940 families survived, and 24 single plants per family were transplanted.

After transplantation, the most mutation, occupied to the total amount of 5.95% and 6.65% in sowing and transplanting families, was the fertility in seed set lower than 50%. Dwarf mutants including tillering, small or big grain, malformed, semi-dwarf and other type were separated and occupied to the second at amount of 1.78% among 8940 families.

Different mutants by M3 separation and selection were listed as following: bright green leaf, chlorosis caused by low temperature, faded green leaf, yellow green leaf, awn, gold hull, white hull, clustered spikelets, extra glume, long grain, minute grain, round kernel, triangular hull, shrunken endosperm, neck leaf, leafy head, long sterile lemmas, depressed palea, lax panicle, pendant panicle, sheathed panicle, short panicle, white panicle, accelerated overgrowth of internode, find culm, lazy growth habit, reduced culm number, drooping leaf, glabrous leaf and hull, narrow leaf, rolled leaf, brown leaf spot, spotted leaf, heading date, late heading, germinating in the panicle, male sterile, open hull male sterile, malformed semisterile, etc.

Some mutants unfound or report before were: brown hull spot, spotted hull, brown sheath spot, spotted sheath, increased culm number, brown pericarp, erect panicle, easier germination, leaf premature senility, necrotic hull, tipsy growth habit, etc.

Two traits to be induced in one family was only faded green leaf with dwarf. Majority was recessive mutation. The mutation frequency took place roughly for 5% for 8940 families.

* This research was supported by National 973 Project (authorized No: G19990116).

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Sequence Analysis of the Soybean (Glycine max L.) Genome and Positional Cloning Major QTLs for Soybean Cyst Nematode (SCN) Resistance

Ming Li Wang

Cereon Genomics LLC, 45 Sidney Street, Cambridge, MA 02139, USA

Two major genes for soybean cyst nematode resistance have been cloned and their function has been predicted. The soybean genome analysis is based on genome-wide genetic maps and studies focusing on individual genes. To gain better understanding of the structure of the soybean genome we have investigated several large contiguous regions of genomic DNA using a combination of genetic mapping, physical mapping of BAC clones, DNA sequence analysis and fluorescent in situ hybridization (FISH). For several of the markers employed in this study, homeologous BAC clones were identified that map to different chromosomes based on both FISH and genetic linkage analysis. At the DNA sequencing level, the BAC clones and their homeologous counterparts are more than 80% homologous. These data support published results suggesting that modern cultivated soybean is derived from an ancient tetraploid. In addition, we also found microsyntenies on the deduced protein level between soybean and Arabidopsis genomes.

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

TBA

Yaoguang Liu

South China Agricultural University

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

TBA

Jiming Jiang

University of Wisconsin, Madison

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Molecular Cloning of cDNA for ECBP21 from Angelica dahurica

Mao Guohong, Ding Cunbao, Hou Lixia and Sun Daye

Institute of Molecular Cell Biology, Hebei Normal University, Shijiazhuang , 050016 , China

Calmodulin (CaM) is an important intracellular Ca2+ receptor protein and has multifunction in various physiological processes by binding with CaM-binding proteins (CaMBPs). Many intracellular CaMBPs were detected and studied. In recent years, CaM has been found not only exist extracellularly, but also has various biological functions both in plant and animal cells. In plant system, Biro et al. first reported the presence of extracellular CaM in soluble extracts of oat coleoptiles cell wall preparation by using radioimmunoassay. In our laboratory, a series of experiments provided evidences that the presence of CaM in the cell wall area is universal,and further work indicated that extracellular calmodulin plays some important roles in the plant kingdom, such as: stimulating the proliferation of suspension-cultured plant cells, cell wall regeneration and cell division of their protoplasts, initiating pollen germination and pollen tube growth, and stimulating the expression of light-independent rbcS. Afterwards, the transmembrane signaling events following the activation of extracellular CaM were studied, for example, indicating that heterotrimeric G proteins may be involved in the signal transduction of extracellular CaM. Thus, we put forward a view that biological functions of extracelllular CaM may acts as a polypeptide signal.

Since intracellular CaM is known to regulate various target proteins or enzymes, detecting and investigating proteins which bind to extracellular CaM could help in understanding its role and the underlying mechanism. Using a biotinylated-CaM gel overlay technique, we first verified the existence of extracellular CaMBPs, and then purified an extracellular Ca2+-dependent CaMBP (named: ECBP21) with a relative molecular mass of 21kDa and isoeletric point of 8.9 from 0.1mol/L CaCl2 extracts of Angelica dahurica suspension-cultured cells. Furthermore, our preliminary evidence shows that ECBP21 may influence on proliferation of this cultured cell. In this study, purified protein was electrobloted onto PVDF membrane and the amino acid sequences from 1 to 20 were determined. Using degenerate oligonucleotides of the sequence, a full-length cDNA coding for ECBP21 was isolated by a combination of RT-PCR and 5¡¯-RACE cloning. The cDNA contains 947 nucleotides that code for a precursor protein of 216 amino acids. The N-terminal 1-25 amino acid sequence is a predicted signal peptide and other 26-216 amino acid sequence is a mature peptide. 26-45 amino acid sequence shows identity with the N-terminal amino acid sequence of purified ECBP21 from Angelica dahurica .The fragment of encoding the mature protein was cloned into pET-28b(+) and transformed into E.coli BL21(DE3) . A protein with relative molecular mass 21kDa was expressed in E.coli. Using a biotinylated-CaM gel overlay technique, the expression protein was tested for its ability to bind CaM. The results indicated that the expression protein is a Ca2+-dependent CaM-binding protein. Thus, these results further defined the cDNA clone for ECBP21.

In recent years, since founding the systemin, several polypeptide signal molecules (like CLV3 and SCR) were found to be present in the extracellular area. More important, it is also proved that they play a very important developmental role. So, extracellular area of plant cell (apoplast) had been revealed as a powerful signal source that could determine the fate of cell development. The further studies about ECBP21 may be benefited for elucidating the mechanism of extracellular CaM or enriching the studies of polypeptide signals in plant kingdom. This work laid a foundation for elucidating the functions of ECBP21 by means of molecular biology. Further studies are being under taken.

Acknowledgements: This work was supported by the National Key Basic Research Special Funds of China (Grant No.G19990117), the National Natural Science Foundation of China (Grant No. 30170476).

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Positional Cloning and Preliminary Functional Analysis of the Rice Fast Elongation Gene eui*

Qun Li, Yonghan Xu, Yongyou Zhu, Haichen Zhou, Zuhua He

SHARF and National Key laboratory of Plant Molecular Genetics, Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 300 Fenglin Road, 200032 Shanghai

Rapid growth of plant has an important impact on crop production under stress conditions. We have been working on a rice mutant with an elongated uppermost internode and rapid growth after heading. This mutation is controlled by a single receive gene eui (elongated uppermost internode). The uppermost internodes in the eui plants can rapidly elongate at heading stage especially in stresses such as flooding and dry conditions, and shows super sensitive to GA3 treatment. Five years ago, we mapped eui gene onto the long arm end of the rice chromosome 5. This gene has been used in the improvement of panicle exsertion in all rice male sterile lines for hybrid breeding, and may participate in the signal transduction of plant cell growth. We are cloning eui gene through map-based approach and studying the mechanism of uppermost internode elongation controlled by the gene at cell and molecular biology levels. Using CAPS£¬SSR makers and taking advantages of public rice genome sequences, we have locked Eui gene within a 35-kb region harboring several candidate genes through map-based method with a F2 generation of Eui ¡Áeui near isogenic lines containing 4000 individuals, eui could be arisen with one base pair mutation . We are doing rice transformation for complementation test to confirm the function of the candidate gene. Cells are much smaller and of higher density in the internodal meristem of the eui plant than these in the wild type. Our current work suggest that Eui gene may encode a suppressor participating in plant cell division related to hormone signaling with tissue and developmental specificity.

¡¡

*This work is partially supported by ¡®863¡¯ project: 2001AA222321.

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Constructing Plant Artificial Chromosome

Sun Yan and Meng Jinling*

National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan, 430070, China; *Email: jmeng@public.wh.hb.cn

To construct a plant artificial chromosomes and introduce it into plant cells would be an effective way to understand the essential elements necessary for maintaining chromosome function and structure in plants. The plant artificial chromosome may also be used as a new vector to introduce hundreds or thousands of Kb DNA segments into target plants. An artificial chromosome should consist of three elements at least, centromere, replication origin and telomere, which are available in Arabidopsis research society. Two YAC clones containing 180 bp repeat sequences in the centromere domain of Arabidopsis and BAC clones containing telomere sequence and ARS (automatic replication sequence) have been collected for constructing artificial chromosome. The telomere sequence in the YAC was confirmed by PCR amplified using telomere repeat primers and by sequencing for the PCR products. A 2000bp fragment of ARS was isolated from the BAC clone by ClaI digestion and subcloned into ClaI digested pBluescript.

The stratagem of constructing plant artificial chromosome is to integrate two plasmid vectors carrying necessary elements into the centromere contained YAC from right and left arms respectively. The left arm vector contained the telomere sequence, the ARS sequence, a kanMX4 gene of G418 selection marker and a truncated TRP1 gene. The right arm vector carries a telomere sequence, the ADE2 gene of selection marker, GFP and a truncated URA3 gene. Retrofitting YAC clones carrying the centromere segment with the constructed right and left arm vectors is being performed by homologous recombination in yeast. The artificial chromosome is going to be transferred into Arabidopsis or Brassica protoplast by liposome-mediated method later this year.

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

¡¡

Rapid Genomic Changes in Newly Synthesized Amphiploids of Intergeneric and Interspecific Hybrids in Wheat: I. Changes in EST Sequences

Fangpu Han1,2 and George Fedak 1

1. Eastern Cereal and Oilseeds Research Centre, Agriculture and Agri-Food Canada, Ottawa, Ontario, Canada K1A 0C6

2. Institute of Genetics and Cytology, Northeast Normal University, Changchun, 120024, China

Allopolyploidy is a major force in the evolution of angiosperms. Nevertheless, the initial events that accompany allopolyploidization are not understood. Recent studies in several model plant systems, including Brassica, Arabidopsis and wheat, indicate that interspecific or intergeneric hybridization, followed by chromosome doubling, can lead to rapid genomic changes such as sequences elimination, novel fragments, gene loss, silencing and activation. In order to further study the genetic and epigenetic changes during allopolyploid formation, we choose several sets of newly synthesized amphiploids with various Triticum and Aegilops species as parents, to study possible changes on representative EST sequences. In this report, we show that following allopolyploidization, rapid changes occurred in EST (Expressed Sequence Tag) sequences.

In the amphiploids between Triticum timophevii and Triticum monococcum, 41.6% EST sequences exhibited changed patterns. EST sequence changes were initiated and completed in different generations. Novel fragments and simultaneous disappearance of two parental fragments were not observed in this cross combination. In contrast, we found a lot of new fragments in the amphiploids between Triticum monococcum and Triticum tauschii. Novel fragments were also found in the F1 hybrids between barley and Elymus humidus. About 33.3% EST sequences detected changes in the F1 hybrids and amphiploids between Triticum asetivum cv. Chinese Spring and Secale cereal. We revealed three types of changes in this cross combination: disappearance of one parental hybridization fragment(s) in the amphiploids, disappearance of one parental hybridization fragment(s) in the amphiploids and some F1 plants, simultaneous disappearance and appearance of rye hybridization fragment(s) in the amphiploids. We also found disappearance of one parental hybridization fragment(s) in the F1 hybrid plant, but re-appearance in the amphiploids. The results indicate that most of the genomic changes occurred are at random. We compared the RFLP patterns between the newly amphiploids and Triticum zhukovskyi, T. urartu and T. monococcum using EST sequences as probes. It is concluded that T. zhukovskyi originated from hybridization of T. timopheevii with T. monococcum, but little divergence occurred during the evolution. On the other hand, strong divergence in the EST sequences was detected between T. urartu and T. monococcum.

Simple Sequence Repeats and Genetic Diversity of Chinese Soybean Land Races

Wang Biao, Chang Ruzhen, Qiu Lijuan

Institute of Crop Germplasm Rerources, Key lab of Crop Germplasm & Biotechnology, Ministry of Agricuoture, CAAS, Beijing 100081, CHINA

It is very important to define genetic diversity of abundant Chinese soybean accessions, which is necessary to reserve and utilize those resources. Genetic diversity of soybean germplasm and resources should be further studied from DNA level with cultivars increased. A sample was obtained at random from primary core collection constructed by the soybean laboratory of the Institute of Crop Germplasm and Resources of CAAS. In the premise of 100% percent coincidence of quality traits and no significance in quantity traits, 190 Chinese soybean land races were obtained as a no deviation sample. 606 alelles were found in 60 loci, with each locus having a mean of 10 alelles, and the mean of gene diversity scores was 0.83, with a range of 0.55¡«0.99. Stand error of similarity matrices were analyzed and the correlation among cophenetic matrices were examined using Mantel test. Genetic diversity was estimated by SSR markers and the proportion and ways in construction of soybean core collection were also studied. The followings were the main results and conclusions of the study.

1.It is possible to eastimate genetic relationships of Chinese soybean land races using SSR marker. The core SSR primers could be selected by distribution of the loci in soybean genome and gene diversity scores. The truely genetic relationships of soybean land races could be reflected using over 570 alelles.

2.Genetic relationship based on SSR data was not consistent with that determined by agronomic traits, more genetic information would be obtained from SSR data associated with agronomic traits.

3.Chinese soybean land races had three high genetic diversity of population, the first was consisted of North Spring planting soybean, Northeast Spring planting soybean and Huanghuai summer planting soybean. The second was the population of South Spring planting soybean and South Summer planting soybean, and South autumn planting soybean was another high genetic diversity population. Soybean land races might be several original places.

4.Alelles, Shannon index and the level of genetic diversity obtained from the proportion of 50%¡¢40%¡¢30%¡¢20%¡¢10% shared by total alelles were compared in the ways of variety classification, and random sample, variety classification and cluster proportion were also compared. Variety classification and 9% proportion were a better choice for constructing soybean core collection.

Key words: Soybean land races; genetic diversity; the level of gene diversity; Simple Sequence Repeats

¡¡

¡¡

Isolation and Characterization of Mutants with Extended Lifespans in Arabidopsis

Cao Shuqing1, Xu Qiaoting1, Zhou Hongjun1, Zhu Yong1, Zhao Huifang1, Dong Xinnian2 and Kuai Benke1,*

1Department of biochemistry, School of Life Sciences, Fudan University, Shanghai 200433, China; 2Developmental, Cell, and Molecular Biology Group, Department of Biology, Duke University, Durham, North Carolina27708-1000; Corresponding author; E-mail: bkkuai@fudan.edu.cn

Maximum lifespan of a species is relatively stable and is mainly determined genetically. It has been found frequently that a single gene mutation may extend or shorten the lifespan significantly in model species. A number of genes regulating lifespans have been cloned recently in model organisms (SCH1, SCH9, CPR1 and SIR2 in Yeast; AGE-1, DAF16, SIR2, CLK1, CLK2 and CLK3 in C.¡¡C.¡¡elegan INR and CHICO in Drosophila; SHC in mouse). Extensive studies have revealed that some common molecular pathways are involved in regulating lifespans in different species, particularly insulin/IGF-1 signaling pathway and generation of ROS and the corresponding response to oxidative stress. In model plant Arabidopsis, however, although mechanisms underlying regulation of flowering time and control of leaf senescence have been studied extensively and three pathways regulating flowering time have primarily been elucidated, little is known about genetic mechanisms involved in the extension of its lifespan. In this study, we have isolated and characterized three Arabidopsis mutants with extended lifespans (designated els1, els2, els3, respectively). Compared with wild-type, the els1 mutant was shorter in stature, with rotund and increased rosette leaves and sunken petioles, as well as reduced male fertility. Although its flowering time was almost identical to that of wild-type plants, the period from flowering to death was significantly prolonged. Its lifespan was consequently extended by 200%. The els2 mutant was significantly larger than wild-type plants, with increased size and number of rosette leaves. The mutant not only flowered later than normal, but also the duration of flowering time was significantly prolonged, which resulted in the extension of lifespan by 150%. The els3 mutant exhibited a similar morphology to wild-type, but its rosette leaves were larger and its plant height was higher. Its lifespan was significantly prolonged by 80%. Genetic analysis revealed that phenotypes of these els mutants were caused by a single recessive mutation. Chromosome mapping of these mutants with simple sequence length polymorphism (SSLP) markers indicated that the els1, els2 and els3 mutations were associated to three loci on two chromosomes: two loci near the markers AthBI2ob (els1) and ciw2 (els3) on chromosome 2, and one locus near the marker nga106 on chromosome 5¡¡us near the marker nga106 on chromosome 5els2). No other loci related to late-flowering have been found in this area. These results suggest that the three loci may be novel and involved in the extension of lifespan in Arabidopsis.

Key words: Extended lifespan; els mutation; Mapping; Arabidopsis

¡¡

¡¡

¡¡

Genetic Relationships among Maize and its Wild Relatives Based on AFLP Analysis

Songjie Tian, Tianyu Wang, Yunsu Shi and Yu Li

Institute of Crop Germplasm Resources, Chinese Academy of Agricultural Sciences, Beijing 100081, China

The understanding of genetic relationships among crops and their wild relatives will facilitate the use of wild germplasm in breeding of cultivated crops. For maize, a wide range of methods, including morphological, cytological and molecular techniques, have been used to clarify the genetic relationships between maize and the putative closer relatives, i.e. teosinte and Tripsacum. However, many basic questions have not been answered yet.

AFLP markers were used to investigate the relationships among cultivated maize, teosinte, Tripsacum and Coix in the present study. Two Tripsacum accessions, five Coix accessions, two Zea diploperennis accessions, one Zea mays subsp. huehuetenangensis accession, three Zea luxurians accessions, two Zea perennis accessions, eight Zea mays subsp. mexicana accessions, nine Zea mays subsp. parviglumis accessions, and 28 Zea mays subsp. mays (cultivated maize) accessions were used in this study. Totally 641 scorable AFLP bands were obtained using 21 PstI/MseI primer combinations, among which 586 bands were polymorphic. Averagely, there were 30.5 bands for each primer combination. Cluster analysis based on UPGMA method revealed that Coix was the most distinct taxa from maize. Tripsacum was also quite different from maize. However, teosintes (including different taxa of Zea except cultivated maize) were most closely related to maize but with considerably high genetic diversity. The relationships among maize inbreds revealed by AFLP markers were basically consistent with the known pedigrees but with a few exceptions.

Key words: maize, teosinte, Tripsacum, Coix, genetic relationship

Genetic Diversity and Genetic Relationships among Maize Germplasm Revealed by SSR and AFLP Markers

Du Jinyou, Tianyu Wang, Yunsu Shi and Yu Li

Institute of Crop Germplasm Resources, Chinese Academy of Agricultural Sciences, Beijing 100081, China

Genetic diversity analysis will help better preserve and use maize germplasm and assign specific accessions to heterotic groups which are of great importance in maize breeding programs, thus increasing the efficiency of germplasm use and improvement.

In this study, we analyzed the genetic diversity of some maize accessions with SSR and AFLP techniques to identify the genetic relationships among these germplasm. The major results of the present study were as follows.

The genetic diversity of 58 maize inbreed lines and one teosinte was analyzed based on SSR markers. Using 40 pairs of SSR primers, totally 259 polymorphic fragments were detected. The range of polymorphic information content (PIC) was 0.14-0.89, with the average of 0.60. The result of cluster analysis showed that the accessions assessed could be clustered into eight groups. This is partly in accordance with the previous classification based on conventional methods but with some differences.

The genetic diversity of 28 maize inbred lines and one teosinte accession was analyzed based on AFLP markers. Totally 535 polymorphic bands were produced with twelve AFLP primer combination (PstI/MseI). Percentage of polymorphic AFLP bands was 72%. In this study, AFLP technique was compared with SSR technique. It was suggested that both systems can be used to analyze the genetic diversity of maize inbred lines. The present study indicated that AFLP markers are more suitable for the assessment of genetic diversity in maize germplasm because of its high frequency of polymorphism.

The genetic diversity of 60 maize inbreed lines with different drought tolerance, which were collected from Europe, the America and China, was analyzed based on AFLP markers. Using 20 AFLP primers combinations, totally 487 polymorphic fragments were detected, with the average of 24.4 for each AFLP primer combination. The result of cluster analysis showed that the accessions assessed could be clustered into four groups which were basically consistent with the pedigrees.

Suitable molecular marker systems for genetic diversity assessment of maize germplasm were proposed according to the results of the present study. Possible relationships between genetic diversity and heterotic groupings were also explored.

Key words: Maize; Drought tolerance; SSR; AFLP; Genetic diversity

Towards a New-Typed Brassica napus with High Compatibility

Maoteng Li and Jinling Meng *

National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan, 430070; *Corresponding author: jmeng@public.wh.hb.cn

Brassica napus (AACC) is one of the most important oilseed crops in China as well as in the world. Special attentions had been paid to quality and yield improvement in Rapeseed breeding in last four decades. But the less polymorphism of B. napus restricted their application in crop improvement for short history. Create new-typed B. napus with alternative genomic combination would be valuable for rapeseed breeding.

It was revealed that B. napus, B. carinata (BBCC) and B. juncea (AABB) are amphidiploid coming from natural doubling of the hybrids of three Brassica diploids, B. campestris (AA), B. oleracea (CC), and B. nigra (BB) thousands of years ago. Divergent evolution and artificial selection has made the A and C genome in B. napus much different from the A genome in B. campestris and the C genome in B. carinata (BBCC) respectively. To distinguish such differentiation, A' and C' are used for the corresponding genomes in B. campestris and B. carinata separately. To combine the A' genome from B. campestris and the C' genome from B. carinata would lead to a new typed B. napus, A'A'C'C' created.

The hexaploid plants (A'A'B'B'C'C') were obtained through doubling the chromosome of interspecific hybrids between B. carinata (B'B'C'C') and B. campestris (A'A'). GISH and molecular markers revered the truly doubled hybrids. The A'A'B'B'C'C' hexaploid plants were pollinated with natural B. napus (AACC, 2n=38) to yield pentaploid seeds with A'AB'C'C genomic composition. GISH results confirmed the pentaploid plant with expected 8 B chromosome number. The expected abnormal meiosis behavior was observed in the A'AB'C'C plants. Hundreds of plants with 38 chromosomes have been obtained through the self-pollination of pentaploid plants. Some of the 38-chromosome plants were B chromosome free and had high rate of A' and C' in genomic composition with good agronomic characteristics. About 100 plants with variable A'C' composition were cross pollinated with natural B. napus (AACC) resulting 700 hybrids, some of them showed very strong biomass and yield heterosis.

Key words: Hexaploid; pentaploid; tetraploid; molecular markers; GISH

Studying on the Genome Recombination between Moricandia nitens and the Crops of Brassica

Chunyu Zhang, Ronggui Huang and Jinling Meng*

National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, P.R. China; *Corresponding author: jmeng@public.wh.hb.cn

To transfer the useful genes of the C3-C4 intermediate species Moricandia nitens into Brassica crops through chromosome homoeologous pairing and recombination, sexual crosses were made between somatic hybrid (M. nitens + B. oleracea) and B. napus, (M. nitens + B. rapa) and B. napus, and between (M. nitens + B. napus) and B. oleracea. Ninety-seven plants out of 232 progenies were trigenomic sesquitetraploids with the genomic composition of MCAA or MACC identified with the observation on their morphological performance, characterization of molecular markers and the chromosome counting. Thousands of seeds were yielded from crosses between MACC and B. rapa, and 98 B. rapa-liked individuals were obtained from 300 self-pollinated individual plants. To screen the recombinants with C3-C4 related characteristic is highlighted.

One of the main characteristics in C3-C4 plants is that the gene encoding the P subunit of glycine decarboxylase (gdcsp) specifically expressed in the vascular bundle sheath of leaf. To develop a STS marker specific for gdcsp of M. nitens would be helpful for screening the target recombination plants in those 98 individuals. Degenerated primers were designed to isolate the gdcsP fragment according the sequence information in Arabidopsis and pea. Two fragments, 2969 bp and 3252 bp, including a 1.3 kb and 1.6 kb upstream domain were obtained by PCR and Genome Walking PCR from M. nitens and B. napus respectively. RT-PCR results indicate that the region of gdcsp, enclosed by the cloned fragments, have the products of transcription. A STS marker specific to M. nitens was designed according to the sequence of cloned fragments. It is verified that the marker is correlated to the C3-C4 character, because the sesquitetraploids plants with the specific band have a little lower CO2 compensation point than that have no band. Using this marker, only one plant has been screened out from those 98 individuals above, but without offspring.

The specific leaf anatomy (Kranz-like structure) in the bundle sheath cells is another main characteristic for C3-C4 plants. Leaf sections were observed under light microscope among the 98 plant lines. One plant from thousands of checked plants showed the kranz-like structure. The ultramicrostructure microscope investigation revealed the C3-C4 anatomy structure. However, the plant did not show any significant changes on the CO2 compensation point comparing with their B. rapa parent.

It is clear that recombination of M/A chromosomes should be happened in the sesquitetraploid plants although the expected C3-C4 plants did obtained directly. An alternatively indirect way might be introduce some key C3-C4 specific genes to those recombinant B. rapa by genetic transformation. Towards the new target, the two 1.3 kb upstream fragments, which containing the promoter region were fused with GUS and GFP and constructed into the expression vector pCAMBIA 1303. The plant transformation works are in process.

Key words: C3-C4 ; Brassica ; recombination; gdcsp; STSs; Kranz-like.

Genetic Diversity, Molecular Identification and Phylogeny of Tea Plant (Camellia sinensis) and its Wild Relatedness in Genus Camellia Revealed by RAPD Markers

Liang Chen1*, Satoshi Yamaguchi 2

1Tea Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou 310008, China; 2 Faculty of Agriculture, Ehime University, Matsuyama 790-8566, Japan

*Corresponding author: E-mail: tbtri@mail.hz.zj.cn; Tel: +86-571-8665 2835 Fax: +86-571- 8665 0056

The genetic diversity, molecular identification and phylogeny of tea plant (Camellia sinensis) and its 23 wild related species and varieties in section Thea genus Camellia were investigated.

Fifteen decamer oligonucleotide primers were selected from the 61 screened. A total of 102 polymorphic bands (6.8 polymorphism/primer) out of 107 reproducible products (7.1 fragments/primer) were amplified from the selected 15 primers, corresponding to 95.3% polymorphism. The relative polymorphic frequency ranged from 0.04 to 0.96. The general frequency was 0.30, varying from 0.16 to 0.60. It was lower than that of intraspecific of tea plant.

According to the presence and absence of unique makers, it was possible to identify 14 of the 24 species and varieties. The combination of band patterns obtained by 4 primers allowed identifying all the species and varieties studied.

Molecular phylogenetic dendrogram and principal coordinate analysis using SHMM method were constructed using UPGMA and Nei and Li¡¯s similarity coefficient from pairwise comparisons of RAPD data between 24 species and varieties. Both in the dendrogram and principal coordinate analysis, the 24 species and varieties of section Thea could be divided into two groups, 5-locule and 3-locule ovary group, and further divided into 3 and 2 subgroups, respectively. Compared with the author¡¯s previous morphological combination of section Thea, they were general consistent with each other. The genetic relationship and molecular evolutionary tendency of some species were discussed from the genetic distance.

RAPD markers not only generally confirmed previous morphological classification and evolution of section Thea in genus Camellia, but also provided reliable and robust method and evidence of the diversity, identification and phylogeny of tea plant and its related species.

Key words: Genetic diversity; Genus Camellia; Identification; Molecular phylogeny; RAPD; Section Thea

¡¡

Identification of Wheat Cultivars Using SSR Markers

Chen Xinmin1, He Zhonghu1, Shi Janrong2, Xia Lanqin1, Rick Word2, Jiang Guoliang2

1Institute of Crop Breeding and Cultivation, CAAS, Beijing 10081; 2Wheat laboratory, Michigan State University, East Lansing, 48824 MI, USA

To carry out the plant protection article and to protect breeder¡¯s right, it needs that the new variety must has special characters that can distinguish it from other cultivars. The morphology traits, such as seeding growth habit, leaf type, plant height, spike type, grain size and color, disease resistance et al., have been used to identify cultivars for many years. However, since the limited number of morphology traits and as more cultivars receive protection, it become more difficult to distinguish new cultivars by using these characters. In addition, since the interchange of germplasms and elite parents among breeders, genetic background of developed cultivars will become more similar. This will further increase the difficulty of identification new varieties by using conventional traits alone. But molecular marker that is numberless can provide the unique DNA characters of a new variety. Thus it shows that use of genetic markers would solve these problems.

Four major kinds of molecular markers, RFLP, RAPD, ALFP and SSR, are often used in wheat. Since the limited number of polymorphism of RFLP and RAPD in wheat and patent protection of AFLP technique, the usage of these three kinds of markers is limited. Nevertheless, SSR is high polymorphism, co-dominant, locus-specific and even distributing in genome. Therefore, it was widely used to build genetic map and genetic diversity study in major crops like wheat, rice, maize and soybean.

In this report, to clarify the function of SSR molecular marker in wheat cultivars identification and to provide scientific basis for variety registration and protection, we applied non-denaturing polyacryamide gel system for SSR analysis. A set of 59 wheat SSR primers located on 21 wheat chromosomes was used to analyze molecular markers of the 79 winter wheat varieties that come from China, USA and Australia. A total of 224 alleles were detected by using the 59 SSR primers. The number of alleles per primer pair ranged from 2 to 12, with average of 3.7. The value of allelic polymorphism information content (PIC) ranged from 0.19 to 0.85, 0.57 per primer on average. Combined 12 primers together, all of the 79 wheat cultivars could be distinguished. The results from this study indicated that SSR markers play an important role in variety identification. The new electrophoresis system is more simple, faster, and more economical than the conventional electrophoresis system.

Key words: SSR markers; Common wheat; Variety identification

Non-Mendelian Phenomena in Allopolyploid Genome Evolution

Bao Liu1, Moshe Feldman2 and Jonathan F. Wendel3

1. Institute of Genetics & Cytology, Northeast Normal University, Changchun 130024, China

2. Deaprtment of Plant Sciences, The Weizmann Institute of Science, Rehovot 76100, Israel

3. Department of Botany, Bessey Hall, Iowa State University, Ames, IA 50011, USA

Perhaps all flowering plants have experienced one or more episodes of polyploidization at some time in their evolutionary history. Recent evidence indicates that this genome doubling may be accompanied by a variety of non-Mendelian phenomena, some of which operate during hybridization and polyploid formation while others manifest more gradually on an evolutionary timescale. Here we present our studies on these phenomena, drawing attention to recent paradigm shifts necessitated by new insights from model plant systems. Allopolyploid formation in some plant groups is associated with an unexplained and in some cases directed process of genomic alteration leading to non-additivity with respect to parental genomes. Novel intergenomic interactions become possible as a consequence of the merger of two previously isolated diploid genomes, variously leading to intergenomic colonization and/or homogenization of formerly diverged sequences. Several epigenetic processes may accompany nascent hybrids and allopolyploids, such as nucleolar dominance, gene silencing and mobile element activation. These myriad phenomena do not characterize all polyploid systems, and some newly formed allopolyploids appear to be genomically quiescent. Although a direct connection to adaptation remains to be established, the surprisingly diversity of genetic and epigenetic responses to wide hybridization and allopolyploid formation and their apparent high frequency suggest that non-Mendelian phenomena contribute directly to polyploid stabilization and diversification.

Key words: polyploidy; molecular evolution; genome duplication; evolution; epigenetics; speciation

Evaluation of Genetic Variation among Iranian Wheat Cultivars Using AFLP Markers

A. A. Shahnejat-Bushehri* and B. E. Sayed Tabatabaei

Department of agronomy, Faculty of Agriculture, University of Tehran,KARAJ/ IRAN, Fax:+98 261 2224511, Shahnejat@hotmail.com

*Corresponding Author

AFLP is based on the selective amplification of a restricted number of genomic fragments. This technology can identify cultivars and specify relationships between closely related plant accessions. The genetic relationships among 16 cultivars of Iranian wheat were investigated using AFLP markers as discriminating characters. Resolved bands were scored for presence and absence in a binary matrix and relationship among cultivars calculated using simple matching coefficients. The results have assisted in the development of a dendogram suggesting genetic relationship among genotypes. Cluster analysis by UPGMA showed that 16 cultivars can be placed in two main groups with a similarity ranging from 0. 456 to 0.776. Variability observed had a narrow genetic base and it is necessary to expand the diversity of the wheat genetic base. With using AFLP, identification of diverse germplasm, selection of parents and estimating of heterosis at molecular level will be possible. Also our results indicated that A FLP technology can generate molecular markers that can be used reliably for DNA fingerprinting of important cultivars.

¡¡

Key words: AFLP; Molecular markers; Polymorphism; Genetic fingerprinting; Iranian wheat.

Development of Chinese Soybean Core Collection. I. Sampling Strategy

Qiu Lijuan and Chang Ruzhen

Institute of Crop Germplasm Rerources, Key lab of Crop Germplasm & Biotechnology, Ministry of Agriculture, CAAS, Beijing 100081, China

China owns the most soybean germplasm in the world, it becomes urgent task how to evaluate and use these collection. In this paper, 23587 cultivated soybean were analyzed by using agronomic characteristics in order to find out optimal sampling strategy and sample size for developing soybean core collection in China. The 20 sampling strategy were used, 18 of them consisted of 3 stratification, 3 sampling number determination and 2 sample selection, and the rest 2 method were checks. The criteria against whole collection included variety classification, mean and variance of 5 quantitative characters, mean and variance of 14 characters genetic diversity, coincidence of 14 characters, mean of variety distance£¬the results indicated that£¬variety classification was better than methods of one and two stratification£¬the proportional sample determination was better than methods of square root and genetic diversity, and clustering selection of sample was better than random selection. Therefore, method 15 would be optimal strategy for developing Chinese soybean core collection. By using this method, various samples with different proportion of whole collection were compare for mean variety distance, and the same size of 9% were taken as the best proportion for construction core collection because it could keep the variation with the least varieties. These results provide important information for better use of Chinese soybean genetic resources.

Key word: soybean; core collection; sampling strategy

Genetic Diversity on Representative Samples from Primary Core

Collection of Soybean (Glycine max) in China

Xie Hua, Qiu Ljuan, Chang Ruzhen

Key lab of crop germplasm and Biotechnology, Chinese Agriculture Ministry; Institute of Crop Germplasm Resources, Chinese Academy of Agricultural Sciences, Beijing 100081; qiu-lijuan@263.net

China is the hometown of soybean; there were abundant soybean germplasm resources. It would be valuable to evaluate the genetic diversity of these accessions. The objective of this study was to analyze the genetic diversity of Chinese soybean germplasms and definite the genetic relationship of them on DNA level by using SSR markers. Through these analyses, instructions could be provided for collecting, using the soybean germplasms, and broadening genetic base in soybean breeding. Important information could also be obtained about the revolutionary relationship between different ecotypes. A total of 405 accessions was selected from the preliminary core collection, which were divided into 5 different ecotypes: northeast spring sowing soybean, Huanghuai summer sowing soybean, southern spring sowing soybean, southern summer and autumn sowing soybeans. A set of 67 SSR primers were used to analyze 405 accessions, and detected 502 alleles with averaged 7.49 alleles per locus. Simpson diversity index varied from 0.501 to 0.898 with the mean value of 0.765, and Shannon-weaver index ranged 0.707-2.445 with the mean value of 1.645. The results indicated that genetic diversity distribution and characteristics of five ecotypes were clarified at molecular and phenotypic levels. The main characteristics of cluster analysis for each of ecotypes were that accessions with same geographic origin and pedigree were clustered together. Evident genetic differentiation existed among five soybean ecotypes.

Key words: soybean; genetic diversity; core collection; SSR marker

Genetic Diversity of D-Genome in Triticum aestivum L. and T. compactum Host. Utilizing Microsatellites

Huiru Peng, Qixin Sun, and Zhongfu Ni

College of Crop Sciences, China Agricultural University Beijing, China, 100094

Triticum compactum and common wheat constitute two of the six groups of the hexaploid wheats with an AABBDD genome. The genetic variations and genetic relationships had been analyzed within and between fourteen common wheat cultivars widely used in world wheat production and thirty two Triticum compactum varieties with 28 D-genome-specific SSR primers, two for each chromosome arm. All 28 D-genome-Specific SSR primers produced amplification products in 46 genotypes. In the 14 common wheat cultivars, a total of 65 alleles were detected on SSR analysis, a number of alleles per WMS ranged from 1 to 8 with an average 2.32; In the 32 Triticum compactum varieties, these 28 SSR indentified 82 alleles in the D genome with an average number of allele per WMS 2.93 (from 1 to 10). The polymorphisms in the D genome of microsatellite markers were found to be higher in Triticum compactum than in common wheat. Genetic distance (GD) between common wheat cultivars of the D genome and each of the investigated Triticum compactum varieties ranged from 0.1034 to 0.4828, the average distance 0.2717. Genetic distances within common wheat and within Triticum compactum were 0.2523 and 0.2773, respectively. The result that there were slight genetic diversity between common wheat and Triticum compactum, which provided useful information to broaden the genetic basis for wheat breeding.

Genetic Diversity of Halophilic Organism in Chinese Salt Lakes and the Application Prospect of Genetic Engineering for Plant Salt Tolerance

Kong Fanjing, Zheng Mianping and Tian Xinyu

Research & Development Center of Saline Lake and Epithermal Deposits, Chinese Academy of Geological Sciences, Beijing 100037 email: kfjbj2002@yahoo.com.cn

Most Chinese saline lakes occur in the west and northeast. They belong to many types according to their chemical composition, such as Chloride type, Magnesium sulfate subtype, sodium sulfate type, carbonate type et al. Since the varied climate, geological position and chemical type of saline lakes, the halophile has much genetic diversity. The species of halophile studied mainly were halophilic bacteria, Artemia, D.salina, Spirulina et al. Most of them have different strains that have special characters. The genetic diversity of these halophilic organisms not only provides directly economical application, but also provides gene resource for gene engineering, especially for the salt tolerance. Many kinds of salt tolerance genes may be cloned from the halophilic organism, and used for plant transformation. The strategy and methods for cloning salt tolerance were discussed. These methods maily are difference display, map based cloning, transposon tagging, homology cloning, and gun-shot cloning, and gene chip et al.

Key words: plant salt tolerance; Genetic diversity; halophilic organism; Chinese saline lakes; genetic engineering

Ribosomal DNA Spacer-Length Polymorphisms in Barley Samples from Three Regions of the World and their Relevance with Origin of Cultivated Barley

Xianghua Li, Caiguo Xu and Qifa Zhang

National Key Laboratory of Crop Genetic Improvement, Huazhong Agriculture University

Wuhan 430070, China

This study was conducted to test two hypotheses related to origin of cultivated barley (Hordeum vulgare, or HV). It was previously proposed that H. agriocrithon (HA) in Tibet was the progenitor of the cultivated barley in the Oriental region, but the difficulty with previous data is that HA did not possess the amount of genetic diversity to account for the genetic variation observed in HV of this region. The two-rowed wild barley H. spontaneum was proposed to be the progenitor of HV in the Occidental region, but the sharp contrast in the occurrence of the rDNA allele 104 was not congruent with such hypothesis. In this study, a total of 192 accessions constituting three samples, including 82 entries of HS from Tibet (sample 1), 57 accessions of HS from 10 countries (sample 2), and 59 accessions from 4 countries (sample 3) coincided with the major barley growing areas in the Middle-East were assayed for rDNA spacer-length variants. A total of 22 rDNA alv phenotypes were detected from which ten slvs were identified as alleles at two rDNA loci. Comparisons of the numbers of the rDNA phenotypes and alleles and the diversity indexes indicated that the HS sample from Tibet possessed the lowest level of genetic variation. Combined analysis of the data from this and previous studies indicated that the two wild forms together did not have the level of genetic variation to account for the amount of genetic diversity observed in the cultivated barley of this region. The 104 allele was again rare in the HS sample from the Occidental region, and in contrast this allele occurred at the highest frequency in HV of this region. Thus, the two gaps concerning the origin of cultivated barley still remain, after combing the information provided by this and previous studies. The implications of such findings remain to be investigated.

Key words: Hordeum vulgare L; Oriental; Occidental; Evolution; rDNA

Selection of Core SSR Primers for DNA Fingerprinting Chinese Soybean Germplasm

Xie Hua, Qiu Li-juan, Chang Ru-zhen, Cao Yong-sheng, Feng Zhong-fu and Zhang Ming-hui

Institute of Crop Germplasm Resources, Chinese Academy of Agricultural Sciences, Key Laboratory of Crop Germplasm & Biotechnology, Ministry of Agriculture, Beijing 100081

In this study, using 96 SSR primers, 845 alleles were obtained in 80 accessions of autumn soybean (Glycine max (L.) Merr) from soybean core collection in China. The number of alleles per primer is 2 to 23 with a mean of 8.8 and polymorphism informative content is 0.141 to 0.938 with a mean of 0.738. 7.00 primers were averagely needed to identify all 80 accessions with the least range of 4 ~ 39 primers. More importantly, the criterion of selecting core primers to study DNA fingerprinting of soybean gemplasm was disussed. The representative, highly informative set of 60 core SSR primers provides a method to build fingerprint of Chinese soybean germplas.

Key words£ºSoybean; Core germplasm; SSR marker; Core primers; Fingerprint

Locating the Rye 45srRNA Gene Using C-Banding-Hybridization in Situ

Ma You-Zhi1, Xu Qiong-Fang1, Xin Zhi-Yong1, Li Lian-Cheng1, TOMITA Motonori2, NAKATA Noboru2, YASUMURO Yoshimasa2, FUKUI Kichi3

1Key Laboratory of Crop Genetics and Breeding, Ministry of Agriculture, Institute of Crop Breeding and Cultivation, CAAS, Beijing, 100081; 2Faculty of Agriculture,Tottori University, Koyama Tottori, 680, Japan; 3Department of Biotechnology, Graduate School of Engineering, Osaka University, Japan

The nuclei of rye (Secale cereal L. CV.¡®Petkus¡¯) were isolated by chromosome microdissection technique and 18S rRNA gene in rye 45S (18S-5.8S-26S) rRNA genes were amplified directly by using these nuclei as templates. Labelling the amplified products (18S rRNA gene) with biotin-16-dUTP, we have succeeded in location of 45S rRNA genes according to chromosome C-banding-Fluorescent in situ hybridization (FISH). The results showed that: (1) the protocols were simplified with the target genes which were amplified by using the isolated nuclei as templates as probes. (2) Using the chromosome banding-hybridization in situ technique have greatly improved the accuracy of gene-locating and it provided a convenient, efficient method for gene locating and physical mapping.

Key words: Gene mapping; C-banding; Fluorescention in situ hybridization; Rye

Identification and its Molecular Markers of a Novel Powdery Mildew Resistance Gene Introgressed from Aegilops umbellulata into Common Wheat

Zhu Zhendong, Jia Jizeng, Zhao Xiuzhen, Zhou Yu, Zhou Ronghua

Key Lab of Crop Germplasm & Biotechnology, Ministry of Agriculture, P. R. China, Institute of Crop Germplasm Resources, CAAS, Beijing 100081

Powdery mildew of wheat, caused by Erysiphe graminis f. sp. tritici, is one of the most destructive wheat diseases in China and most wheat growing areas in the world. Growing resistance varieties is the most economical, environmental safe and effective means to control this disease. So far, 45 genes (Pm) in 30 loci for resistance to powdery mildew have been identified. Some of these genes have been used in commercial varieties. Due to high genetic variability of the pathogen, the single resistance genes often are defeated by new virulent pathogen strains in a relatively short period. It is therefore necessary to continuously screen for new resistance genes to powdery mildew to guarantee the progress of resistance breeding.

Aegilops umbellulata Zhuk. ( 2n = 2x = 14, UU ), a wild Mediterranean grass, is a valuable source of resistance genes to pests that infest wheat. In 1965, an leaf rust resistance gene, Lr9, was intogressed into common wheat from Ae. umbellulata by radiation induced recombination, and the gene has been effective in a range of wheat growing areas yet. An accession of Ae. umbellulata, Y39, was identified to be immune to some virulent isolates of E. graminis f. sp. tritici and Puccinia striiformis f. sp. tritici in China. In 1990, an amphiploid, named Am9, was synthesized from the cross between Triticum carthlicum ( accession number: PS5 ) and Ae. umbellulata ( Y39) by Xu et al (1990). Afterward the resistance genes to powdery mildew in Am9 were transfered toward common wheat variety Laizhou 953.

A F4:5 segregating population, derived from BC3F4 of the cross between Am9 and Laizhou 953, then backcrossed to Laizhou 953, was identified for resistance to powdery mildew in seedling stage in greenhouse. Of 82 plants, 41 plants were resistant, and 41 plants were susceptible, it showed that the transmission of resistance gene was unstable in the segregrating population. Two microsatellite markers, Xgwm296 and Xgwm257, were linked to the resistance locus, and no recombination was found between the two markers and the resistance gene. Primer pair WMS296 amplified two fragments in Laizhou953 and all plants, the two fragment should respectively be on wheat chromosome 2AS and 2DS according to Röder et al. (1998). WMS296 amplified a fragment with size of 130 bp in Y39 and all resistance plants. WMS257 amplified fragments with sizes of 180 bp and 190bp in Y39 and Laizhou953 respectively. Of detected 71plants, 15 resistant plants were only amplified one fragment with size of 180 bp, 22 resistant plants were amplified two fragments with sizes of 180 bp and 190 bp, all 34 susceptible plants were only amplified one fragment with size of 190 bp. It indicated Xgwm257 should be a co-dominant marker. Because Xgwm296 and Xgwm257 are on wheat chromosome group 2, the resistance gene should be in the chromosome 2U of Ae. umbellulata. And the 2U fragment containing resistance gene should be translated to wheat chromosome 2BS. The research on size of translocation fragment and translocation breakpoint is in progess.

A Genetic Linkage Map of Bread Wheat

Hao ZF1, Chang XP1, Guo XJ2, Wang YF2, Jing RL1*, Jia JZ1

1Key Laboratory of Crop Germplasm & Biotechnology, MOA, P.R. China, Institute of Crop Germplasm Resources, CAAS, Beijing 100081, China, *Corresponding author: jingrl@yahoo.com

2Shanxi Agricultural University, Taigu 030801, Shanxi, China

Hexaploid bread wheat (Triticum aestivum L.) is one of the most important crops in the world and understanding its genetics and genome organization using molecular markers is of great value for genetic and plant breeding purposes (Marion S. Röder et al. 1998). For the objective, a doubled haploid population with 219 lines derived from the cross between two cultivars, Hanxuan 10 and Lumai 14, was established. Marker analysis was performed with 90 randomly chosen DH lines, and different marker types were applied, with an emphasis on SSR and AFLP (PstI and MseI) markers. By amplification, electrophoresis and silver stain, primer sets with distinct amplified polymorphic signal between two parents were 304, including 242 SSR (123 Xgwm, 98 WMC and 21 cSSR designed from known functional cDNA sequences) and 62 AFLP primer sets. Among these three kinds of SSR markers, the percentage of polymorphic primer sets in Xgwm marker was the highest, and in cSSR marker the lowest, reached 53.5% and 8.0%, respectively. In addition WMC marker¡¯s polymorphism reached 18.2%. At LOD > 3.0, a genetic linkage map including 348 loci amplified by 273 primers sets was constructed by means of sofeware MAPMAKER/EXP3.0 (Stephen E. Lincoln, Mark J. Daly and Eric S. Lander, 1993) and GENEMAP(private correspondence). The total genetic length was 3931.4 cM and average distance between loci was 11.3 cM. According to located Xgwm SSR primer sets reported by Röder in 1998, 20 cSSR, 98 WMC and 51 AFLP primer sets are mapped onto the genetic linkage map. In general, the distribution of loci in all genome is partially inclined to B genome accounting for 45% of all markers. This result may indicate that the genetic diversity in B genome was higher than in A or D genome which were 42% and 13%, respectively. In this map, some cSSR primers sets coming from known similar functional genes were mapped on their chromosomes, with clustering in several regions. This genetic linkage map will be used to do genetic research and serve molecular breeding of bread wheat.

QTL Mapping of Resistance to Asian Corn Borer in Maize

Yongtao Yu, Yanchun Song, Yunsu Shi, Tianyu Wang, Yu Li

Institute of Crop Germplasm Resources, Chinese Academy of Agricultural Sciences, Beijing 100081, China

Maize production in China has been seriously affected by corn borer, especially Asia corn borer (Ostrinia furnacalis (Guenee)). Integrated pest management has been paid great attention to in China but it applies to only 20% of maize fields annually. That is, about 80% of the growing area (about 16 million ha) is open to this pest. If the annual rate of yield decrease were 10%, it implies that the maize production of 1.6 million ha would be lost.

From the economic and scientific view, breeding for corn borer resistance should be a priority in reducing the damage of this pest. Suppose that single-cross hybrids with moderate resistance could be planted on the half of these 16 million ha and the yield could be 2500 kg/ha, the total production of 20 million tons would increase. Since the 1970s, breeding for corn borer resistance has made progress but it has not been very effective because the inheritance of the Asia corn borer resistance which were believed to be controlled by quantitative trait loci (QTL) is complicated. Other reasons include: (1) results of evaluation for resistance under natural conditions are not very reliable due to the instability of climate; (2) progeny evaluation in the field must wait until the late stages of plant growth; (3) artificial infestation needs techniques to raise insects and is not easy to be operated by ordinary breeders. Molecular marker assisted selection (MAS) may be one of useful ways to raise breeding efficiency. Its prerequisite is tagging genes conferring traits of interest. As for the resistance to Asian corn borer, the genetic mechanism has not been very clear although that it is a quantitative trait has been known. Through genetic mapping of QTL controlling the resistance, marker-assisted selection and isolation of genes with major effect will become practical and easier.

The 120 F2:3 families of ¡°H21 ´ Mo17¡± were phenotyped in 2000 and 2001 by artificial infestation in terms of leaf feeding damage and stalk tunnel damage and genotyped using 71 SSR and AFLP markers. Three QTLs were identified for resistance to leaf feeding damage on chromosome 1, 2 and 5, and four QTLs were identified for number of holes on stalk on chromosome 1, 3 7 and 8. No QTLs were found for stalk channel length but three QTLs were identified for the channel length per hole on chromosome 1, 4 and 9. Besides, five, two and three QTLs were detected for plant height, leaf width and leaf angle, respectively. Presently, more markers are adding to the linkage map to accurately map QTLs conditioning the resistance. In addition, another mapping population ¡°K36 ´ Zi 330¡± is using for QTL analysis for this important traits.

Key words: maize; Asian Corn Borer resistance; QTL mapping

Preliminary Mapping of QTLs for Scab Resistance in a Native Resistant Germplasm of Wheat

Zhengqiang Ma, JizhongWu, Huilan Zhu, Zhongxin Kong, Feng Lin, Yigao Feng, Dajun Liu

College of Agricultural Sciences, Nanjing Agricultural University, Nanjing, Jiangsu 210095, P. R. China, zqm2@njau.edu.cn

Scab disease, caused by Fusarium head blight, has been a major concern for both wheat producers and farmers, since it not only lowers the yield but also deteriorates the quality of wheat grains. More than one quarter of China¡¯s wheat grown area suffers from the damage by wheat scab, for which heavy epidemic occurs every 3-5 years. Deployment of scab-resistant varieties is the choice of measures in controlling this disease, however, the paucity of germplasms and lack of knowledge of the genetics underlying the resistance has greatly limited the progress in scab breeding. To identify genes for scab resistance, resistance germplasms identified from a pool of indigenous collections were crossed with susceptible cultivars to produce mapping populations by single seed descent (SSD). 150 lines from one of the SSD population were planted in greenhouse and field for resistance screening. The spike was inoculated by single floret inoculation of the spores at flowering stage. Mist system was used to maintain the moisture suitable for disease development. Fifteen days after the inoculation, data were collected for number of diseased spikes, number of diseased internodes and length of diseased rachis. SSR markers were screened for polymorphisms of the parents and between the resistant and susceptible pools. The polymorphic markers were applied in genotyping of the populations. Using one-way ANOVA, four potential chromosome regions showed significant association with scab resistance. Two of them were identified using both the field and greenhouse data. The QTL with the largest effect explained 10-15% of the phenotypic variance. Its actual effect might be much higher since the data of lines, differing greatly in heading date, suffered from variation caused by the environments. The identification of QTLs for scab resistance paves the way for discovery of scab resistance genes and marker-assisted selection of scab resistance.

QTL Mapping and Gene Transferring for Antibiosis to Green Leafhopper in Rice

Chunming Wang1,2, Hideshi Yasui2, Atsushi Yoshimura2, Huqu Zhai1 and J. Wan1¢Ù

1State Key Laboratory of Crop Genetics and Germplasm Enhancement, Rice Research Institute, Nanjing Agricultural University, Nanjing 210095£»2 Faculty of Agriculture, Kyushu University, Fukuoka 812-8581, Japan

¢ÙCorresponding author:E-mail: wanjm@mail.njau.edu.cn

Nephotettix virescens (Green Leafhopper: GLH) is one of the major insect pests of rice in the temperate Asian rice region. To exploit the genetic potential of insect pest resistance, 125 recombinant inbred F10 lines (RIL) were developed from a cross between a japonica cultivar Taichung65 (Susceptible to GLH) and an indica cultivar ARC10313 (Resistant). An RFLP linkage map based on the RILs was constructed, which contained 113 well-dispersed RFLP markers. Total map length is 1462.4cM. The orientation of RFLP markers is in good agreement with that of the previously constructed maps. Nine GLH resistance genes (Glh1-glh8, Glh) and 4 Green Rice Leafhopper (GRH), Nephotettix cincticeps resistance genes (Grh1, Grh2, Grh3 and Grh4) have already been identified. In this paper, QTL for antibiosis to GLH were detected on Chromosome 3, 5, 11 and 12. Of them, the QTL near XNpb292 on chromosome 12 for increasing GLH mortality was from the japonica variety. The other three QTL were from indica variety, two of which on chromosome 3 and 11 were close to Grh2, and Grh4, respectively. Therefore, the resistance to GLH was further studied with near isogenic lines of Grh2 and Grh4 derived from a cross of susceptible variety Kinmaze (japonica) as recurrent parent, and resistant variety DV85 (indica). The results revealed that the interaction of these two GRH resistance genes also expressed strong resistance to GLH. None of the 9 GLH resistance genes is so far known to be located on chromosome 3 or 11. Up to now, 2 QTL resistant to GLH newly identified in ARC10313 were detected on chromosome 3 and 11 in this study, the locations of which are almost the same as those of Grh2 and Grh4.

Grh2, one of green rice leafhopper, N.cincticeps resistance genes was located on chromosome 11 of resistant variety DV85 (Indica). Taichung 65 is a Japonica cultivar with elite characters, but susceptible to green rice leafhopper. C189 and G1465 are two RFLP markers flanking Grh2 gene, which were transformed into CAPS markers this study. Both phenotypic selection and CAPS marker assistant selection were conducted in BC6F2 population derived from the cross of Taichung65 and DV85 in order to pick out the important breeding materials with Taichung65 background and resistance to green rice leafhopper. The linkage distance was calculated with the molecular and phenotypic data, meanwhile the effect of the selection method was analyzed. Since the experimental methods in this paper, including rude extraction of DNA, CAPS primer design, and the method of CAPS marker assistant selection, were characterized by fast, easy, and high effective to operate, it can be applied broadly to the selection for various agronomic traits.


Key Words:
Rice; Green leafhopper; Green rice leafhopper; Antibiosis; RFLP; CAPS; QTL

¡¡

Detection and Analysis of QTLs for Ferrous Iron Toxicity Tolerance in Rice, Oryza sativa L.

WAN Jian-lin1, ZHAI Hu-qu2, WAN Jian-min1* and H.Ikehashi3

1State Key laboratory of crop genetics and germplasm enhancement, Nanjing Agricultural University, Nanjing 210095, People's Republic of China£»2 Chinese Academy of Agricultural Sciences, Beijing 100081, People's Republic of China; 3 Department of Breeding ,Nihon University,1866 Kameino, Fujisawa-shi,Japan

*Corresponding author;e-mail: wanjm@mail.njau.edu.cn

The gleyic paddy soils are widely distributed in People's Republic of China, Sri Lanka, India, Indonesia, Sierra Leone, Libya, Nigeria, Columbia and Philippines. The gleyic paddy soils are estimated to cover 7.5 to 8.0 million hectares, in People's Republic of China, where ferrous iron toxicity in the gleyic paddy soils is reported to reduce rice yield by 10-20% depending on the intensity of toxicity and the tolerance of the rice cultivar.

Fageria and Rabelo measured the effect of excess iron on plant height, root length, and root and shoot dry weight. Based on comparison of the dry matter yield and reduction of shoots at higher Fe2+ concentrations with those under optimum or control treatment, rice cultivars were classified into tolerant, moderately tolerant, moderately susceptible or susceptible. Among the 40 cultivars tested, one was tolerant, six were moderately tolerant, 17 were moderately susceptible, and 16 were susceptible at the 0.89 mM Fe2+ concentration. These results show that rice cultivars differ widely in tolerance to excess Fe2+.

A mapping population of 96 BC1F9 lines (Backcross Inbred Lines: BILs), derived by a single-seed descent method from a backcross of Nipponbare (japonica)/Kasalath (indica)// Nipponbare, was used to detect quantitative trait loci (QTLs) for ferrous iron toxicity tolerance in rice (oryza sativa L.). A hydroponic culture experiment was applied to evaluate the reactions of two parents and 96 BILs to ferrous iron toxicity, and the leaf bronzing index (LBI)¡¢stem dry weight (SDW)¡¢tiller number (TN) and root dry weight (RDW) were recorded as phenotypic values of each BILs for detection of QTLs for ferrous iron toxicity tolerance. A total of four significant QTLs were detected on chromosome 1 and 3, respectively, with LOD of QTLs ranging from 3.17 to 7.03. One QTL controlling LBI¡¢SDW¡¢TN and RDW was located at the region of C955-C885 on chromosome 1, and their contribution to whole variation were 20.5%¡¢36.9%¡¢43.9% and 38.8% respectively. Another QTL controlling SDW and RDW was located at the region of C25-C515 on chromosome 3, with respective contributions of 47.9% and 35.0% to whole variation. Further, two QTLs on chromosome 1 were located for RDW at the region of R1928-C178 and for TN at the region of R2329-R210.There is a linkage between a QTL for ferrous iron toxicity tolerance and a QTL for phosphorus-deficiency tolerance on chromosome

Key words: BIL population; Ferrous iron toxicity tolerance; QTL analysis; Rice

¡¡

Identification of Molecular Markers for the Rust Resistance Gene M4 and the Wilt Resistance Gene Fuj7(T) in Flax

BO Tian-yue1,2,3, SUN Zhen 1, ZHAI Wen-xue2, ZHU Li-huang2 and YE Hua-zhi 3

1Cold Region Crop Research Institute, Shanxi Academy of Agricultural Sciences, Datong

037008,China; 2Institute of Genetics, Chinese Academy of Sciences, Beijing 100101,China;3 Sichuan Agricultural University, Ya¡¯an 625014,China

Flax (Linum usitatissimum L.) is an important fiber and oil-producing crop. However, flax production has been restricted by some diseases, among them, flax rust caused by Melampsora lini Ehrenb.Lev. and flax wilt caused by Fusarium oxysporm f.sp.lini are two main diseases in flax. The most effective method to control these diseases is to screen and to breed resistant varieties. By identifying the molecular markers for resistant genes to flax rust and wilt, we hope to set up a procedure for maker-assisted selection in flax disease resistance breeding. The major results in this paper are as follows:

1. Identification of molecular markers for the rust resistance gene M4 in flax

RAPD analysis of five near-isogenic lines, which contain M1, M2, M3, M4 and M5 resistant(R) gene to flax rust, respectively, and their common recurrent parent, Bison, was carried out with 540 decamer primers. Two primers£¬OPA18 and OPC06£¬could stably amplify additional DNA fragments in the NM4 line which contain the R gene, M4. Using the F2 mapping population derived from a cross of Bison¡ÁNM4, the M4 gene was shown to be closely linked to an additional DNA fragment OPA18432 with a genetic distance of 2.1 cM. The cloned OPA18432 was sequenced and then transformed to a SCAR marker. Analysis of different resistant materials with this marker proved its specificity for the M4 gene. Development of this M4 linked marker provides a good groundwork for marker-assisted selection in flax rust resistance breeding. Especially, the M4 gene performs high resistance to several rust pathogens in China, so it is more valuable than others are. The specific molecular marker for M4 gene could been amplified from Jinya 8, a flax cultivar bred by the author, proving that it contain the M4 gene.

2. Identification of molecular markers for the wilt resistance gene FuJ7(t) in flax

A cross between wilt resistant flax variety, Jinya 7, which was also bred by the author, and susceptible variety, Jinya 1, was made for mapping wilt resistance gene(s). Through inoculation test of its F1 and F2 progeny, it is proved that two dominant genes control the resistance of Jinya 7 to wilt. With 48 EcoRI/MseI primer combinations, AFLP analysis was performed on two parents and their F2 resistance and susceptibility bulks. A total of about 3300 distinguishable bands were amplified, of which three were stable. The linkage analysis of the three polymorphic DNA fragments with the resistance gene(s) was tested in the F2 segregating population between Jinya 7 and Jinya 1. The DNA fragment AG/CAG was found closely linked to one of the wilt resistant genes, with a genetic distance of 5.2 cM, which was tentatively named FuJ7(t). The cloned fragment AG/CAG was sequenced and then transformed to a SCAR marker, which can be used more conveniently in the identification and marker-assisted selection for gene FuJ7(t).

Key words: Flax or Linseed (Linum usitatissimum L.); Rust; Wilt; Resistant gene; Molecular

marker; RAPD; AFLP; SCAR

Molecular Characterization of Fusarium Head Blight Resistance Gene in Wheat Cultivar Wangshuibai

Xu Zhang1, Miaoping Zhou1, Lijuan Ren1, Hongxiang Ma1, Weizhong Lu1*, Peiguo Guo2 and Guihua Bai2

1) Institute of Agrobiological Genetics and Physiology, Jiangsu Academy of Agricultural Sciences, Nanjing, 210014, P.R.China 2) Department of Plant and Soil Sciences, Oklahoma State University, OK, 74078, USA

*Correspondence author: wzlu@public1.ptt.js.cn

Wheat Fusarium head blight (FHB), mainly caused by Fusarium graminearum, is one of the worldwide destructive disease of wheat. It causes both severe yield loss and decrease in grain quality. In addition, FHB contaminates cereal products with mycotoxin. Breeding wheat resistant to the disease is the preferable approach to minimize the damage caused by FHB. Sumai3 and its derivatives such as Ning7840 have been used as the sole resistance resource for genetic research and breeding application in many breeding programs. Resistance genes from Sumai3 and Ning7840 have been well characterized through molecular mapping. However, resistance in Wangshuibai, a Chinese landrace with high and stable scab resistance performance, is still a puzzle to be answered.

To characterize FHB resistance gene in Wangshuibai, a genetic population of 104 F7-derived recombinant inbred (RI) lines was developed from the cross between resistant landrace Wangshuibai and susceptible cultivar Alondra. Evaluation of FHB resistance was carried out in Nanjing 1998 and 2000, Wuhan 2000 and USA 2001 respectively with single floret inoculation. A total of 32 informative AFLP primers were chosen to detect markers in RI lines. About 250 markers have been mapped in 23 linkage groups covering a genetic distance of 2430 cM. Another 83 SSR primers were screened in RI lines. ANOVA analysis indicated that 28 AFLP markers were significantly associated with FHB resistance gene (P<0.005). Integrated map with AFLP and SSR markers showed that markers linked to resistance gene were localized on the chromosome 3B and 1B respectively. Primary result of Quantitative Trait Loci (QTL) analysis also showed that there were 2 QTLs of FHB resistance in Wangshuibai on the chromosome 3B and 1B, which further supported the conclusion.

Identification of Microsatellite Markers Linked to the Gene Pm5e for Resistance to Powdery Mildew in Common Wheat (Triticum aestivum L.)

Xiuqiang Huang1 (* ) ¡¤ Lixin Wang2 ¡¤ Minxin Xu2,3 ¡¤ Marion Roeder1

1Institute of Plant Genetics and Crop Plant Research (IPK), Corrensstr. 3, D-06466 Gatersleben, Germany; 2Crop Institute, Beijing Academy of Agricultural and Forestry Sciences, Beijing 100089, P.R. China; 3Present address: Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, P.R. China.

Powdery mildew (Pm), caused by Erysiphe graminis DM f. sp. tritici (Em. Marchal), is one of the most important diseases of common wheat worldwide. Among the 30 documented Pm genes, the recessive gene Pm5 was located on chromosome 7B. Up to now, six alleles were reported at the Pm5 locus. Wheat variety ¡®Fuzhuang 30¡¯ carries the gene Pm5e and has proven to be a valuable resistance source of powdery mildew for wheat breeding. Forty microsatellite markers, which were mapped on chromosome 7B of wheat in the ITMI population, were chosen for screening of polymorphism between two parents of the F2 mapping population from the cross ¡®Nongda 15¡¯ (susceptible)/¡®Fuzhuang 30¡¯ (resistant). Microsatellite fragments were detected on an automated laser fluorescence (A.L.F.) sequencer and analysed using the computer program fragment analyser (Pharmacia). Linkage relationship between DNA markers and the gene Pm5e was established with MAPMAKER/Exp version 3.0b. LOD scores ³ 3.0 were used to develop the linkage map.

For the molecular mapping of the gene Pm5e in ¡®Fuzhuang 30¡¯, a total of 100 F2-derived F3 families from the cross between ¡®Nongda 15¡¯ and ¡®Fuzhuang 30¡¯ were tested with race no. 15 of powdery mildew. The observed segregation of 22 homozygous resistant, 55 heterozygous and 23 homozygous susceptible families fitted a 1:2:1 segregation ratio (c 2 = 1.02, 0.50 < P < 0.60). Among the 40 microsatellite markers, 21 (52.5%) produced polymorphism between two parents, indicating that microsatellite markers revealed a high level of polymorphism in wheat cultivars. Seven microsatellite markers, namely Xgwm577, Xgwm783, Xgwm883, Xgwm984a, Xgwm1144 and Xgwm1267, were found to be linked to the gene Pm5e, of which two codominant markers Xgwm783 and Xgwm1267 were relatively close to Pm5e with linkage distance of 11.0 cM and 6.6 cM, respectively. It is possible to use the 136 bp-allele of Xgwm1267 in ¡®Fuzhuang 30¡¯ for marker-assisted selection during the wheat resistance breeding process for the facilitation of gene pyramiding. The gene Pm5e was mapped in the distal region of chromosome 7BL with the map distance of approximately 145 cM to the centromere and located between Xgwm1267 and the RAPD marker UBC405-628 which was linked to the gene Pm5e with the linkage distance of 12.6 cM in the previous study.

In addition, a microsatellite linkage map of chromosome 7B was constructed using the same mapping population. Nineteen microsatellite loci were mapped on chromosome 7B, nine on the short arm and ten on the long arm. This information will be very useful for further mapping of agronomically important genes of interest on chromosome 7B.

Tagging and Mapping of Rice Thermo-Sensitive Genic Male Sterile Gene Tms5 Using RIL Population

Xing QH1 *, Wang YG1 *, Liang FS1, Deng QY2, Yuan LP2, Wang B1 and Weng ML1**

1.Institute of Genetics, Chinese Academy of Sciences, Beijing 100101, China

2.China National Hybrid Rice Research and Development Center, Changsha 410125, China

* With equal contribution

** Corresponding author: mlweng@genetics.ac.cn

Annongs-1, a thermo-sensitive genic male sterile (TGMS) rice line, has a new TGMS gene. Genetic analysis indicated that the sterility of Annongs-1 was controlled by a single resessive gene which was named as tms5. In our previous study, tms5 was mapped on chromosome 2 with an F2 population from the cross between Annongs-1 and Nanjing11. Recently, a RIL (recombinant inbred line) population from the same cross was developed and used for fine mapping the tms5 gene.

AFLP, RAPD, RFLP and SSR techniques combined with BSA (bulked segregant analysis) were used to screen molecular markers linked to the target gene. As a result, two AFLP markers (E:AA/M:CTG400, E:AT/M:CAC420), one RAPD marker (OPE-16350)), and four SSR markers (RM279, RM492, RM327, RM324) were linked with tms5 gene. The tms5.gene was located between Rm492 and E:AA/M:CTG400 with a genetic distance of 5.4 cM and 3.0 cM respectively. Unfortunately, no RFLP markers show polymorphism between the two parents of our RIL population, although there are some RFLP markers located at very close loci in the JRGP map, such as C365 and G227,

In order to find markers more closely linked with tms5 gene, four SSR primer-pairs.(SSR1, SSR2, SSR3 and SSR4) were designed based on the nucleotide sequence of C365 and G227 found in GENEBANK. Then, these 4 SSR primers were used to amplify Annongs-1, Nanjing11 and the individuals of their RIL population. The result showed that SSR1400 derived from C365 was closely linked to the tms5 gene with a genetic distance of 1.04 cM. A CAPS marker (CAP1450) derived from a SSR product SSR4750 linked to the tms5 gene with a genetic distance of 2.08 cM.

The BAC library of AnnongS-1 was screened using G227 and C365 as probes, and eight positive clones were obtained. A BAC contig covered 240 Kb in tms5 gene-encompassing region was constructed.

Key Word: Rice; TGMS gene; tms5; BAC; Mapping

This research was supported by Plant Transformation Project (J99-A-002)

Morphological Analyses of a Stable Cotton Homeotic Variant (Chv1)

Guo Yulong, Xue Meifeng, Li Mingyang, Pei Yan* and Zheng Shangyong

Biotechnology Research Center, Southwest Agriculture University, Chongqing 400716 China

*Corresponding author, E-mail, peiyan@swau.edu.cn; Tel, 86-023-68251883

Physiological and genetic variations exist richly in the cotton plants regenerated from somatic embryo. A stable homeotic variant (chv1) of cotton from regenerated plants was identified. Using light microscope and scanning electron microscope to investigate the morphological changes in chv1, the results revealed that all the floral organs in the chv1 plants converted into leaves, meanwhile the placenta and ovules bearing on the basal part in central leaf-like organs can be discerned. A flower of the variat consists of three to seven bracts, fourteen to thirty one leaf-like organs. Arrangement of the leaf-like organs is intermediate between spiral and whorl.

The floral organ mutant, chv1, may be a useful material in the research of cotton flower development and somaclonal variation. Firstly, The chv1 provide an evidence to support old theory in cotton, that flower organs are modified leaves. This theory is supported by the observation that triple mutations lacking all three of the ABC gene activities and make all flowers become leaf-like. Secondly, although the carpels of the chv1 have converted to leaf-like organs, ovules still emerged at the base of the organs, which normally bear on the axile placeta. This observation supports Angenent¡¯s viewpoint that the ovule should be seen as another class of floral organs. Finally, the chv1 is a somatic variant, and the research of molecular mechanism of somatic variant is still in infancy. Further study on the genes involving the mutation of chv1 will help us to shed light on the mechanism of somatic variations.

Key words: cotton; floral organs; somatic mutation

Funded by the National Natural Science Foundation of China (Grant No. 30080001)

Analysis of Major QTL for Wheat Scab in Wangshuibai/Alondra Population

Miaoping Zhou1, O.E. Scholten2, Lijuan Ren1, Xu Zhang1, Guihua Bai3, Hongxiang Ma1 and Weizhong Lu1

1 Institute of Agrobiological Genetics and Physiology, Jiangsu Academy of Agricultural Sciences, Nanjing 210014, China

2 BU Genetics and Breeding, Plant Research International, 6700AA Wageningen, The Netherlands

3 Department of Plant and Soil Science, Oklahoma State University, Stillwater, Oklahoma 74078-6028, USA

1.Construction of linkage maps

A population of 104 F7-derived recombinant inbred lines developed by single seed descent from common wheat cross of Wangshuibai (resistant)/Alondra (susceptible) was used for this research. With JoinMap3.0, the integrated linkage maps were constructed using 292 polymorphic markers, including 143 SSRs, 145 AFLPs and 4 RAPDs. 189 markers could be mapped and they formed 19 linkage groups, covering a total genetic distance of 988 cM. For 17 linkage groups their chromosome identity could be determined based on the microsatellites map of wheat published by R?eder. Apart from chromosome 3D, 4B, 5D, 6D, the other chromosomes maps were obtained. About 30% polymorphic markers couldn¡¯t be constructed to linkage maps. The major reason is the linkage maps didn¡¯t cover the whole genome of wheat. Some markers have no sufficient linkage with the mapped markers. In order to get the complete linkage maps, more additional markers need to be used to saturate the maps.

2.Analysis of major QTL for wheat scab resistance

The scab resistance of individuals of Wangshuibai/Alondra was evaluated in the field of Nanjing and the greenhouse of Oklahoma State University. QTL of resistance for scab was firstly analyzed by Kruskal-Wallis Analysis, then Interval Mapping and MQM (multiple-QTL model) Mapping were carried out using MapQTL4.0 software. The analysis result was output using MapChart2.0. Kruskal-Wallis Analysis showed that BARC147, Xgwm493 and BARC102a linked closely to resistance for scab (p<0.005). Which indicated there is a QTL in this chromosome region. Interval Mapping also detected a prominent QTL on chromosome 3BS between BARC147 and BARC102a with LOD>2.8 in two places data. This QTL was as similar as the major QTL of Sumai3 and could explained 14.5% phenotypic variance. With the flank markers of QTL used as cofactor, MQM Mapping displayed this QTL was located between BARC147 and Xgwm493 with LOD >2.82. The genetic distance of this fragment is 10.5 cM.

¡¡

Identification of 1BL/1RS Translocation via Multiplex PCR Markers of Glu-B3, Gli-B1 and SEC-1b in Common Wheat

ZHANG Li-Ping1, HE Zhong-Hu12, LU Mei-Qin3, PANG Bin-Shuang4, ZHANG Xue-Yong4, XIA Lan-Qin1 and Frank Ellison3

1National Wheat Improvement Center, Institute of crop breeding and cultivation, Chinese Academy of Agricultural Sciences (CAAS), Beijing 100081; 2 CIMMIYT China Office, Beijing 100081£»3 Plant Breeding Institute, the University of Sydney, Narrabri, NSW 2390, Australia; 4Institute of Crop Germplasm Resources, Beijing 100081

Glu-B3 STS-PCR, Gli-B1 SSR and SEC-1b STS-PCR markers are used for identification of loci for LMW glutenin, gliadin and secalin, respectively. Results indicate that cultivars and advanced lines such as CA9632, Jinmai45, Lankao24, Yannong18, Jingdong8 and 39 doubled-haploid lines of Zhongyou9507/CA9632, both of Glu-B3 and Gli-B1loci are absent, but SEC-1b is presented. In addition, secalins are detected using PAGE and ELISA, and the results are identical to that detected by multiplex PCR. Furthermore, 28 F2 plants of Zhongyou9507/CA9632 were tested, which shows that the multiplex PCR also can detect homogenous and heterogeneous plants carring 1BL/1RS translocation.

Key words: Common wheat; Glu-B3; Gli-B1; SEC-1b; 1BL/1RS translocation

Mapping of Quantitative Trait Loci Underlying Chlorophyll Content in Rice

WANG Bing, WU Weiren, LI Weiming and LAN Tao

College of Crop Science, Fjian Agriculture and Forestry University, Fuzhou 350002

Chlorophyll content is closely related to photosynthetic ability in plants. The enzyme system of chlorophyll biosynthesis has been studied deeply, but its genetic basis remains unclear. The present study aimed to map quantitative trait loci (QTLs) underlying chlorophyll content in rice, using a population of recombinant inbred (RI) lines derived from a cross between two indica rice varieties, H359 and Acc8558, and a corresponding molecular marker map. Seeds of the RI and parental lines were sown on 14 July, 2001 and transplanted to the field on 5 Aug. Contents of chlorophylls a and b of each line were investigated on 20 Aug., 9 Sept., 23 Sept. and 10 Oct., respectively. Data of the four stages were analyzed jointly with the method of multiple-trait composite interval mapping. Six QTLs were detected for chlorophylls a and b, respectively. Among them, five QTLs were mapped on the same position for the two traits, indicating that the contents of chlorophylls a and b have the same genetic basis. This is consistent with the fact that chlorophylls a and b share the same biosynthetic path. All QTLs were mapped on chromosomes 1 and 4, except that one QTL for chlorophyll b was located on chromosome 11. This implies that chromosomes 1 and 4 are important for chlorophyll content in rice. Most of the QTLs exhibited significant effects only in some stages, but there was a QTL showing significant effect throughout the period of observation and, particularly, having the largest effect on the chlorophyll content in flag leaf, suggesting that the QTL is important for photosynthesis in rice. It is interesting that three QTLs related to chlorophyll content were previously mapped in sorghum by two independent studies on linkages G, B and J, which happen to be collinear with rice chromosomes 1, 4 and 11, according to comparative genomics in cereals.

Study on Intergenomic Heterosis between New-typed Brassica napus and Natural B. napus

Wei Qian and Jinling Meng*

National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan, 430070

* Author for correspondence: jmeng@public.wh.hb.cn

Strong interspecific heterosis on biomass has been observed among F1 plants (A'AC) between Brassica napus (AACC) and B. rapa (A'A'). However the triploid hybrid could not be utilized as commercial variety because of abnormal meiosis and poor seed production. If the A genome in the B. napus is substituted with the A' genome of B. rapa, a new-typed B. napus with A'A'CC genomic composition would be created. And the strong interspecific heterosis may be utilized in the intergenomic form of A'ACC produced from crosses between the new-typed B. napus (A'A'CC) and natural B. napus (AACC). A serial of new-typed B. napus (A'A'CC) lines were creased by backcrossing the F1 (A'AC) plants to B. rapa and selfing the BCF1 plants followed morphologically and cytologically identification and marker-assisted selection on the progenies.

Five natural B. napus were used as male parents to cross-pollinate to four new-typed B. napus (A'A'CC) lines (new ´ nature) and two natural B. napus varieties, which were used as parents to create the new typed B. napus (nature ´ nature). Thirty intergenomic hybrids were produced in NC design . The parents and F1 hybrid plants were grown with a randomized complete block design with 3 replications in 2001. Biomass and seed yield were investigated. The mid-parent heterosis for biomass, seed yield and harvest index was 36.87%, 58.16% and 17.15%, respectively. General combining ability (GCA) effect of female and male for biomass and yield was significant or very significant. SCA effect was only significant in harvest index. These results indicated that some main genes with additive effect controlled the biomass and the seed yield. The correlation coefficient between the seed yield and the biomass reached to 96.59%, which revealed that the biomass heterosis in the interspecific hybrids had a real potential to be transformed to intergenomic heterosis of seed yield when the unbalance of chromosome pairing to be solved. The seed yield in the highest ¡°new ´ nature¡± was significantly higher than that of ¡°nature ´ nature¡± and commercial hybrids, 37% and 38% respectively. It proved not only the A'/A or A'/C intergenomic interaction, but also the commercial value of intergenomic hybrids.

Key word: new-typed Brassica napus; natural Brassica napus; intergenomic heterosis; GCA; genome interaction

Mapdraw: a Microsoft Excel Macro for Drawing Genetic Linkage Maps Based on Given Genetic Linkage Data

Renhu Liu and Jinling Meng*

National key laboratory of crop genetic improvement, Huazhong Agricultural University, Wuhan, 430070

*Corresponding author, jmeng@public.wh.hb.cn

MAPMAKER is one of the most widely used computer software package for constructing genetic linkage maps. However, the PC version, MAPMAKER 3.0 for PC, could not draw the genetic linkage maps that its Macintosh version, MAPMAKER 3.0 for Macintosh, was able to do. Especially in recent years, Macintosh computer is far more unpopular than PC. Most of the geneticists use PC to analyze their genetic linkage data. So new computer software to draw the same genetic linkage maps on PC as the MAPMAKER for Macintosh do on Macintosh have been crying for.

Microsoft Excel, one component of Microsoft Office package, is no doubt the most popular software in laboratory data processing. Microsoft Visual Basic for Applications (VBA) is one of the most powerful functions of Microsoft Excel. Using this program language, we can take creative control of Excel, including genetic linkage map construction, automatic data processing and more. In this paper, a Microsoft Excel macro called MapDraw is constructed to draw genetic linkage maps on PC computer based on given genetic linkage data. Use this software, you can freely construct beautiful genetic linkage map in Excel and freely edit and copy it to Word or other applications. This software and its help information is just a Microsoft Excel file named MapDraw.xls. You can freely copy this software from ftp://211.69.140.177 and the source code can be found in Excel¡¯s Visual Basic Editor.

Keywords: Genetic linkage map construction; Microsoft Excel; MapDraw

Efficiency Selection of Genetic Background Using SSR Markers in Soybean

Duan Hongmei, Qiu Lijuan and Chang Ruzhen

Key Lab of Crop Germplasm and Biotechnology, the Ministray of Agriculture/ Institute of Crop Germplasm Resources, Chinese Academy of Agricultural Sciences, Beijing 100081; qiu-lijuan@263.net

Soybean is an important economical crop and main resource of protein. Soybean seeds contain at least three lipoxygenase isozymes lipoxygenase1, 2 and 3. These isozymes are responsible for the production of unpleasant grassy and beany flavors in soybean seeds that have limited the development of soybean products for human consumption. Treatments with heat, acid, alcohol or antioxidants have been employed to reduce the concentration of compounds that contribute to the undesirable flavors. An alternative solution to this oxidation problem would be to genetically eliminate lipoxygenase from seeds.

Developing seed lipoxygenase-free soybean cultivars with desirable agronomic and seed characteristics is the best solution. Aim of this study is using markers to reduce the number of backcrossing generations to obtain desirable lines for further backcross based on the lines with lacking of lipoxygenase. The targeted gene is detected by IEF-PAGE; using SSR markers to accelerate the recovery of the recurrent parent genome, to select the ideal lines, which not only have the desirable gene, but also have little difference with the genetic background of an elite variety called Ludou 4.

The main results are as follows:

51 pairs of SSR primers used in the research have specific alleles of ludou 4. On the soybean molecular linkage group, only H and L linkage groups have one SSR locus, the other 18 linkage groups have at least two SSR loci and the loci were evenly distributed.

A procedure was useful in marker-assisted background selection. That is, first use limited numbers of markers to screen all the individuals, eliminate the individuals not fit the requirements, then use more makers to screen the residuals. With this method, ideal individuals can be obtained with high efficiency.

A line lacking Lox-2 was got, which can be seen as a near-isogenic line of loudou 4 based on the background selection results. Candidate lines were chosen for further backcross with ludou 4, to accelerate the process of getting near-isogenic lines of loudou 4 lacking different types of lipoxygenase.

SSR Markers of Gene Resistant to Southern Rust in Inbred Line P25 of Maize

LIU Zhangxiong and WANG Soucai

College of Crop Science, China Agricultural University, Beijing, 100094

Genetic analyses of resistance to southern rust (caused by Puccinia polysora Underw.) was studied with mixed the major-gene and polygene inheritance model, using the high-resistant inbred line P25 and the high-susceptible inbred line F349 and their single crosses. Besides, by 174 F2:3 lines, a genetic linkage map of maize (Zea mays. L) was constructed, and the resistant gene was mapped. The main results as follow:

1£®According to the symptoms and morphology of summer spores of the corn rust, determined that the rust infested on the susceptible inbred line F349 was the southern rust.

2£®Worked out the method to evaluate incidence. Used a major-additive gene model to explain the inheritance of the resistant gene in P25, and detected no polygene. Heritability for resistance was about 81.88%¡¢38.14% and 55.1% in the F2¡¢B1 and B2 population, respectively.

3£®78 out of 200 SSR markers were polymorphism in both parents, and polymorphic ratio was 39%. The maize genetic linkage map contained 74 SSR markers, covering genome 2165.9 cM, and average distance among markers is 29.27 cM.

4£®One resistant gene to southern rust was mapped on 10th chromosome, and the distance to phi095 is 5.8 cM.

Keywords: Mixed-genetic model; SSR; Molecular marker; Linkage map; Location; Corn; Southern rust

Development of PCR-Based Markers for Powdery Mildew Resistance Gene Pm4a

Zhengqiang Ma, Jingbo Wei, Xiaowei Gu and Li Xiong

College of Agricultural Sciences, Nanjing Agricultural University, Nanjing, Jiangsu 210095, P. R. China, zqm2@njau.edu.cn

Gene tagging is the basis of marker-assisted selection and map-based cloning. Ma et al (1994) reported a co-segregating RFL marker xbcd1231of Pm4a, a dominant powdery mildew resistance gene of wheat that is still active in combating powdery mildew disease in many wheat-growing areas. xbcd1231 has been successfully used in marker-based breeding for powdery mildew resistance. So far, there is no better PCR-based marker available for this gene, which is needed to simplify the molecular genotyping process. Thus, we decided to convert xbcd1231 to a STS marker. To this goal end sequencing of BCD1231 was performed. PCR of the genomic DNA of Pm4a isogenic lines with a pair of STS primers, designed based on the sequence information, amplified a 1584 bp monomorphic fragment. However, nucleotide polymorphism of this amplified product between the two isogenic lines was discovered after four-cutter enzymes Hae III and Msp I were applied. A F2 population of 88 plants was surveyed with this STS marker and the polymorphism was co-segregating with the resistance, which is consistent with corresponding BCD1231 RFLP genotyping result. To identify more markers tightly linked to Pm4a, a group of SSR markers were also surveyed for polymorphism between the isogenic lines. One polymorphic SSR marker was found and was applied in genotyping the segregating population. Linkage analysis showed that it was 1.9 cM from Pm4a. These PCR-based markers will make the identification of Pm4a in breeding materials an easier process.

Comparisons of QTLs for Yield Traits Detected in F2:3 and RIL Populations from the Same Cross in Rice

Y. Z. Xing, S. B. Yu, C. G. Xu and Qifa Zhang

National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University

In this study we reanalyzed the QTLs underlying four yield traits for data of an F2:3 population from a cross between two indica rice varieties, Zhenshan 97 and Minghui 63, and the results were compared with that of recombinant inbred line (RIL) population from the same cross. The analyses of data from both populations were conducted using composite interval mapping with LOD threshold 2.4. Totally, 33 QTLs were identified for the four traits in F2:3 population. Of them, 19, 2 and 12 showed partial dominant, full dominant and over dominant effects. Twenty-five QTLs, distributed on 9 of the 12 chromosomes were detected for the four traits in RILs. Comparison of the QTLs detected in the two populations showed that 8 of the 19 QTLs showing partial dominance, 1 of the 2 QTLs showing full dominance and 1 of the 12 QTLs showing over dominance, detected in the F2:3 were also detected in the RILs. Of the 10 QTLs detected in both populations, 1, 2, 3 and 4 QTLs affected yield per plant, tillers per plant, grains per panicle and grain weight, respectively. The results also clearly showed that the QTLs for the traits with high heritabilities were more likely to be detected in both populations, as were the QTLs with large additive effects. Three QTLs with pleiotropic effects observed on chromosome 3, 5 and 7 were also detected in both populations. The above results implied that QTLs with large effects could be detected across generations and could be used as the targets to improve quantitative traits using marker assistant selection.

QTL Mapping of Resistance to Sugarcane Mosaic Virus in Maize

Fengge Wang1, Xiande Liu1, Zhenhua Wang2, Shihuang Zhang1*, Xinhai Li1, Lixing Yuan 1, Xiaoqing Han3 and Mingshun Li1

1Institute of Crop Breeding and Cultivation, CAAS; Key Laboratory of Crop Genetics and Breeding, Ministry of Agriculture, AMBIONET-China Lab, Beijing 100081, China

2College of Agronomy, Northeast Agricultural University, Harbin , Heilongjiang ,150030, China

3Tangshan Institute of Agricultural Sciences, Tangshan, Hebei, 063001, China

*Corresponding Author: cshzhang@public.bta.net.cn

Maize dwarf mosaic is an important widespread virus disease of maize (Zea mays L.) in the world, causing significant losses in grain and forage yield in susceptible genotypes. It has also become a major concern in China, where it is mainly caused by sugarcane mosaic virus (SCMV), formerly also denoted as maize dwarf mosaic virus strain B (MDMV-B). For ecological and economical reasons, the cultivation of resistant maize varieties is the most efficient method to control the virus disease. However, information regarding the genetic basis of resistance to SCMV in Chinese maize germplasm is still lacking.

To study the resistant mechanism of maize to SCMV, in this research, a F2 population with 184 individuals derived from cross Ye107 (susceptible) ¡Á Hangzao4 (resistant) was used to construct a genetic map and analyze QTLs resistant to SCMV. The population of 184 F3 lines was evaluated for SCMV resistance under artificial inoculation. Among 300 SSR primer pairs, 102 amplified polymorphism clearly between two parents, of which 65 were used to analyze genotypes of the F2 population. A genetic linkage map with 65 SSR markers was constructed by mapmaker /EXP 3.0b£¨LOD=3.0, r=0.4£©,covering 1333.3 cM on total ten chromosomes with an average interval length of 20.5 cM. Using software QTL cartographer v1.30, by the method of composite interval mapping (walk speed: 1cM; window size: 10.00cM; background marker: 5; model: 6; regression method: Forward & Backward; LOD=2.80), three QTLs conferring resistance to SCMV were identified on chromosomal bin 3.04, 6.01 and 10.04, flanked by markers phi053, phi077 and phi062, and explained 17.8%, 6.1%, and 7.0% of the phenotypic variance, respectively. The gene action was additive for the QTL on chromosome 3, while partially dominant for the QTL on chromosome 6 and 10. By the method of multiple interval mapping (walk speed: 1cM; window size: 10.00 cM; background marker: 5; model: 6; regression method: Forward & Backward; BIC: c(n) = ln(n) ), no significant epistatic interactions were found between QTLs, and three QTLs together explained 30.2% of the phenotypic variance.

Key words: Genetic linkage map; SCMV; SSR markers; QTL

Genetic Analysis, Tagging and Mapping of Maize Stalk Rot Resistant Genes

Yang Dianer1, Chen Shaojiang2, Jin Demin1, Zhang Chengliang2, Yang Jilang1, Cheng Cuixia1 and Wang Bin1 *

1Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China; 2China Agricultural University, Beijing 100094, China

*Corresponding author

Maize stalk rot is one of the serious diseases that often cause great loss of maize production. Studying the resistance to maize stalk rot is becoming important and urgent. The two major pathogens causing maize stalk rot, Pythium inflatum Mattew, and Pythium graminicola Subram, were inoculated respectively to inbred lines 1145, Y331 and their crossbred F2 , BC1 populations. The result showed that any one of the two pathogens can cause maize stalk rot, and that the symptoms caused by these two pathogens separately are the same, and are not different from that caused by the mixed two pathogens. The maize stalk rot was directly caused by the pathogen that we inoculated, because only the one kind of pathogen that was inoculated could be isolated from the inoculated susceptive plants until 4 days after the symptoms appeared. Other pathogens usually could be isolated 4 days later after the symptoms appeared. The segregation ratio of resistant plants to susceptive plants was 3:1 and 1:1 respectively in the F2 and BC1 populations from the cross of 1145 and Y331. This indicates that the resistance is controlled by one dominant gene in the cross of 1145 and Y331, and that the resistant gene is come from the resistant parental line 1145. In order to find markers linked to the resistant gene, bulk segregation analysis (BSA) was performed. Four markers (OPZ-191100£¬OPA-04880£¬OPF-091100 and OPF-161000) were found to be linked to the Rpi1 gene, however only one of them, OPZ-191100, is single copy in maize genome. Three markers (OPA-181000£¬OPD-201000 and OPY-04900) were found to be linked to the Rfg1 gene, but only one of them, OPY-04900,, is single copy in maize genome. Using OPZ-191100 and OPY-04900 as probes, Rpi1 and Rfg1 were mapped on chromosome 4 and chromosome 6 respectively in the RIL F7 mapping population from the cross "Mo17¡ÁS3". The genetic distance between Rpi1 and OPZ-191100 is 16.6 cM; The genetics distance between Rfg1 and OPY-04900 is 6.1cM. Rpi1 and Rfg1 are located on different chromosomes. According to the nomenclature of disease resistant gene, the resistant gene to Pythium inflatum Mattew was named as Rpi1. In the same way, the resistant gene to Fusarium graminearum Schw was named as Rfg1. Then, based on the primary mapping results, 4 RFLP probes and 25 SSR primer-pairs flanking the Rpi1, 5 RFLP probes and 29 SSR primer-pairs flanking the Rfg1, were selected from maize linkage map, and their linkage relation with Rpi1 and Rfg1 respectively were tested for fine mapping these two genes. Result indicated that 3 RFLP marker and 2 SSR markers were linked to Rpi1 gene on chromosome 4 and that 3 RFLP marker and 3 SSR markers were linked to Rfg1 gene on chromosome 6. Rpi1 was located between phi079 and umc242, it was 1.6 cM from phi079, and 7.0 cM from umc242, while Rfg1 was located between mmc0241 and bnl3.03, it was 2.0 cM from mmc0241, and 3.0 cM from bnl3.03.

Key words: Maize, Tagging and Mapping, Disease resistant gene, Rpi1, Rfg1.

* This research was supported by NSF project of China (39893350)

Identification and Molecular Tagging of Two Complementary Dominant Resistance Genes to Maize Dwarf Mosaic Virus

WU Jian-yu, DING Jun-qiang, DU Yan-xiu and CHEN Wei-cheng

College of Agronomy, Henan Agricultural University, Zhengzhou 450002

Corresponding author: wtong@public2.zz.ha.cn

Introduction: Maize dwarf mosaic virus is one of the devastating and widespread viral diseases in the world. It has been becoming economically important in many areas of China. The breeding and cultivation of resistant varieties is the basic and most important way to prevent the yield losses caused by the pathogen. The resistant materials and their inheritance pay an important role in the efficiency of resistant breeding. Many reports showed that both major genes and polygene have involved in the resistance to the virus. Only a few genes have been identified in the resistant materials in the world. An elite inbred line, Siyi, has been newly screened with resistance genes to the virus. Two complementary dominant genes have been identificated on chromosome 3 and 6 by microsatellite markers respectively, which is a basic work for the marker assistant selection and map based cloning of the resistance genes.

Materials and methods: The parents, F1, F2 and backcrosses from the combination Siyi¡ÁMo17 were planted to study the inheritance of the resistance to maize dwarf mosaic virus, and F2 progenies were used to map the new resistance genes.

Results: The resistance to maize dwarf virus was investigated based on the average of chlorosis of functional leaves on a plant of parents, F1, F2 and backcrosses from the combination Siyi¡ÁMo17. Both parents Siyi and Mo17 differed significantly for resistance to MDMV in two years. Siyi expressed complete resistance at adult stage. 31 plants in 2000 and 60 plants in 2001 of Siyi¡ÁMo17 were symptomless. The (Siyi¡ÁMo17)¡ÁSiyi plants in 2001were resistant. (Siyi¡ÁMo17)¡ÁMo17 progenies both in 2000 and 2001segregated into a 1:3 ratios while (Siyi¡ÁMo17) F2 progenies in 2001 segregated into a 9:7 ratios .The genetic model, two complementary dominant genes model, were found in the resistant ¡Ásusceptible combination with two years, and then 87 pairs of microsatellite primers distributed randomly on 10 chromosomes were selected. Two pairs of microsatellite primers, phi029 on chromosome 3 and phi126 on chromosome 6 link tightly with the two resistance genes respectively, the linkage distances between phi029 and the resistance gene on chromosome 3 is 14.5 cM, and phi126 to the other on chromosome 6 is 7.2 cM, which confirmed the genetic analysis.

Discussion: There is a resistance gene family to MDMV nearing to the centromere of chromosome 6, in which a few resistance genes, Mdm1 in Pa405, a major recessive resistance gene in Huangzaosi, and a major QTL in FAP1360A, were identified. One resistance gene on chromosome 6 in Siyi was located on the region. There is the other resistance gene family to MDMV on chromosome 3, in which a few resistance genes, the other major QTL in FAP1360a, the resistance gene on chromosome 3 in Siyi, were identified.

¡¡

¡¡

Molecular Evaluation on Wheat Near Isogenic Lines for Powdery Mildew Resistance

TIAN Qing-Zhen, ZHOU Rong-Hua and JIA Ji-Zeng

Institute of Crop Germplasm Resources, Chinese Academy of Agricultural Science; Key Laboratory of Crop Germplasm & Biotechnology, Ministry of Agriculture, Beijing, 100081, China

The near isogenic lines for wheat powdery mildew resistance were evaluated with the AFLP technique. Greater genetic variance was detected in donor parents of the near isogenic lines, and good genetic consistency was found in the NILs. Characteristic bands of the resistance gene to powdery mildew Pm21 and Pm13 were found, which could be used in the identification of the disease resistance genes and the near isogenic lines.

As important genetic stocks for the study of gene mapping, tagging and gene cloning, the near isogenic lines (NILs) were attached importance in recent years. Powdery mildew of wheat, which is caused by the fungus of Erysiphe graminis DC, has been a serious disease in China as well as many wheat production areas in the world. To date, thirty genes conferring powdery mildew resistance have been found in wheat. In our laboratory, with the recurrent parents Bainong 3217 and Beijing 837, several NILs for powdery mildew resistance have been bred. These NILs have been backcross after five to seven generations, but the similarity to the recurrent parent and the consistency in the NILs have not been evaluated in molecular level.

In our study, the background of eight NILs with the respective resistance genes Pm4b, Pm2/Pm6, Pm12, Pm13, Pm16, Pm21 and two unknown resistance genes were evaluated using the AFLP technique. All the NILs were bred with the recurrent parent (RP) Bainong3217. Twelve combinations of primer were used, and in total 791 bands were detected, in which 339 were polymorphic. The average polymorphic bands rate amounted to 42.86 percent, and the genetic diversity coefficent averaged to 0.4086. But the genetic diversity mainly focused among the parents (resistance donor). In total, 325 polymorphic bands were found among the parents, accounting for 41.34 percent of the total. Only 62 polymorphic bands were detected in the NILs, accounting for 8.04 percent. The genetic diversity of the donors was 0.6900, whereas the genetic diversity of the NILs was 0.090. Therefore, it could be concluded that greater consistency had attained in the NILs.

The Jaccard genetic similarity coefficients between the NILs and the RP were calculated. The average similarity between the NILs and the RP averaged to 0.96. The NIL1 with Pm4b showed the greatest similarity to the RP (0.9848), and the genetic similarity among the selected lines amounted to 0.9932. The second was NIL5 with Pm16, with the similarity 0.9815 to the RP, and the similarity among the selected lines was 0.9932. The NIL3 with Pm12, although it was backcrossed after 7 generations, showed less similarity to the RP (0.9683). So NIL1 with Pm4b, NIL5 with Pm16, and NIL2 with Pm2/Pm6 were evaluated as better NILs for further study.

In the donor parents, Hongquanmang, the accession from T. aesvitum, owned the most similarity to the NILs, in the next place were Mardler and VPM, an accession of T.aestivum and a translocation line from common wheat and wild relatives. Line31, R43, R1A, which were the translocation lines from common wheat and wild relatives, owned less similarity to the NILs. Am6, which came from the dibiploid of the durum accession DR147 and the accession Ae39 from Aegilops squarrosa L., showed greatest genetic difference to NILs. So it was obvious that AFLP could reveal the correct genetic relation of the NILs and their donors.

After analysis all the bands of the NILs, the RP and the donors, we found two bands, M-CGA/P-ACT-500 and M-CGA/P-ACC-300, were specific for NIL6 with Pm21 and its donor R43. After further analysis in the F2 segregating population, we found that the bands were present only in the resistant plants, and they could be seen as the markers of Pm21. Another band M-CTG/P-AGC-270, was found specific for NIL4 with Pm13 and its donor R1A, a translocation line from T. aestivum and Agilops longissima.. These bands would be useful in the identification of the NILs and map cloning of the resistance genes.

Mapping of Quantitative Trait Loci for Agronomic Traits in Wheat (Triticum aestivum L.)

Dongcheng Liu1, Runzhi Li1, Shuanghe Cao1, Like Liu1, Xiangbo Xu1, Xiaoli Guo2 and Aiming Zhang1,3*

1Department of Plant Genetics & Breeding, China Agri. Univ., Beijing 100094, China

2College of Biology, China Agri. Univ., Beijing 100094, China

3Institute of Genetics and Developmental biology, CAS 100101, China)

* Corresponding author: amzhang@genetics.ac.cn

A genetic linkage map of wheat including 247 SSR markers was constructed by using 240 F2:3 lines derived from a winter wheat hybrid ¡°ND3338¡ÁF390¡± with high heterosis. The population including 240 F2:3 lines and its parents were grown in a randomized incomplete block design of one-row plot with three replications in two locations (Beijing & Shijiazhuang) across two years (1999 & 2000) and evaluated for ten agronomic traits including yield per plant and its three components. The results were as follows:

1£®A total of 538 SSR markers were screened to identify polymorphisms between two parents and 265 markers showed polymorphisms at a rate of 49.3%. A genetic linkage map covering the wheat genome 3067cM with an average marker interval of 12.4cM was constructed including 247 SSR markers in which 180 were co-dominant markers and the distorted segregation was found in 32 markers at a rate of 12.9%.

2£®Except for chromosome 3A, 5B, 5D, 7B and 7D, 47 QTL in other 16 chromosomes were found affecting the yield and its components in which 6 for yield per plant, 10 for averaged kernel per spike, 10 for 1000-kernel weight and 21 for spike per plant, and the total explained phenotypic variations were 7.2-22.2%, 4.9-27.8%, 32.6-49.4% and 22.4-44.6% respectively. Of the 47 QTLs, 12 were detected over two environments.

3£®Of the 60 QTL detected in other six traits, six were revealed for plant height, 15 for spike length, 8 for ear emergence date, 10 for spikelet per spike, 7 for kernel per plant and other 15 for main spike kernel, and 24 QTL were appeared in two or more than environments. The QTLs for three traits (plant height, spike length and ear emergence date) with high heritability could be detected in most of the environments and their total phenotypic variations were 52.4-58.6%, 28.7-48.1% and 23.2-29.4% respectively.

4£®Many QTLs were found affecting more than one trait, especially in chromosome 2D, 4B and 4D. For example, the QTL on chromosome 4D DP1-Xgwm192, not only affected plant height, but also controlled other three traits (ear emergence date, 1000-kernel weight and spike per plant).

5£®With respect to the QTL¡¯s direction and action, the increased value came from the allele of the low parent in nine traits except for plant height, and 72 QTLs showed partial dominant effect at a rate of 42.6%, 40 QTLs had over-dominant effect at a rate of 23.7%, and the additive and dominant were 29 (17.1%) and 28 (16.6%), respectively.

6£®Composite interval mapping based on mixed model was used to analyze the interaction effect in the data of Beijing in 2000, and many epistasis interactions, especially additive ¡Á additive interaction, were found except for plant height and kernel per plant, which showed that partial dominant, over-dominance and epistasis interaction may act as an important role on the genetic basis of heterosis.

Synthesis of [AG] Complex Genome and Tri-Species Hybrid with [A¡¢D¡¢G]

Binglin Li, Dongli Fan and Zhibeng Yi

Shanxi Agricultural University, Taigu, 030801, P. R. China

Gossypium bickii, a wild allodiploid cotton originating in Oceania, has the feature of delaying the forming of oil glands in seeds, which means that there is no gland or no gossypol in seeds before germination. By hybridizing wild diploid bickii (G1G1) as paternal plant with cultivated diploid (G.arboreum) [A2A2] as maternal plant in 1980, We obtained an allodiploid (A2G1), whose chromosomes were then doubled and a fertile allotetraploid (A2A2G1G1)(2n=4x=52) was achieved. The allotetraploid hybrid has steadily passed on the merit of having no gland in seeds but having it in plant body for 8 generations, which makes it possible to breed a cultivated vatiety, with the comprehensive utilization of cotton fibre, protein and oil and resistance to insects. The allotetraploid has reproduced for 8 generations. Crossing G. hirsutum and G. barbadase with the allotetraploid produced the triple hybrid.

Seed embryo (cotyledon) of the allotetraploid is white and has no gland, which is stably inherited because no gland was observed in hundreds of seeds in the past 5 generations. The gland was observed in hundreds of seeds in 5 consecutive generations. The glands in cotyledon are in light colour after germination and become black gradually. All the other organs appear later with glands. The content of gossypol in seed embryo is 0.0158%, lower than the permitted content stipulated by FAO and WHO.The behavior of chromosomes in 105 PMC in metaphase I of meiosis revealed that most of the M. (A2G1) chromosomes were unpaired.the number of bivalentsranged from 1 to 6,and trivalents were observed in 7 cells. The chromosome configuration was 16.4I£«4.0¢ò£«0.4¢ó. The average crossing frequency of the rod bivalents was 1.07. Between two poles and in tetrad stage 6¡ª8 or even 10 spores were formed, leading to hypersterile pollen. The PMC meiosis of the allotetraploid was observed, showing that there were 52 chromosomes. Most of them were circular bivalents, and the crossing frequency was 1.83 in average. The chromosome configuration was 2.75¢ñ+24.5¢ò+0.25¢ó, and the cells containing 26 bivalents accounted for about 30% of the cells observed. Therefore, in telophase ¢ò normal tetrads were formed, which led to the developnment of normal pollen granule. The fertility of (A2A2G1G1) allotetraploid was recovered. Bolls and seeds have been obtained for 8 generations.

The whole plant in the tri-species hybrid looked roughly like upland cotton. While the character of pubescence was more like G. bickii, denser than G.arboreum and G.hirsutum; The gossypol contents of the triple hybrids ranged from 0.00125 percent to 0.0481 percent, much lower than the glanded upland cotton varieties and close to the standard (0.02%-0.04%) set by WHO and FAO.The analysis of (A2¡ÁG1 ) ¡Á(AD)1 chromosome karyotype is following as:

The karyotype formula of (A2¡ÁG1): 2n=4x=52=50m(6SAT)+2Sm;

The karyotype formula of (AD)1: 2n=4x=52=50m+2Sm+(2SAT);

The karyotype formula of(A2¡ÁG1)¡Á(AD)1: 2n=4x=52=2M+44m(SAT)+6Sm(SAT).

Total of 137 RAPD amplified bands of the triple hybrid (A2¡ÁG1)¡Á(AD)1 F1 were acquired, among those 73.7% of the DNA bands are similar to the parents. 65.6% of 131 (A2¡ÁG1)¡Á(AD)2 F1 bands amplified and 61.4% of 145 (A2G1)¡Á(AD)2 F1 bands amplified are similar to their parents. The amplification results using primer OPAV-19 shows that the triple hybrid not only has the bands of amphiploid G.arboreum ¡Á G.bickii, but also has its own specific one.

Identification of Powdery Mildew Resistant Gene-pyramid in Wheat

Luo Yinghao1,2, Chen Xinmin1, Xia Langqin1, He Zhonghu1, Chen Xiao1 and Ren Zhenglong2

1 Institute of Crop Breeding and Cultivation, CAAS, Beijing, 100081.

2 Sichuan Agricultural University, Yaan, 625014

Breeding durable resistance to pathogens is a major task for modern plant breeders. Pyramiding different resistant genes into a genotype is one way to breed wheat cultivars with durable and broad-spectrum powdery mildew resistance. With the large number of pathogen isolates, the traditional method of Pm gene identification based on resistance to individual isolate is time-consuming. Molecular marker that can be used to identify the specific resistant gene quickly and precisely will provide a tool in pyramiding multiple genes and speeding up the gene pyramiding process in breeding.

Biochemical marker, STS-PCR marker and SCARS-PCR marker, which are tightly linked with Pm4b, Pm12, Pm13 and Pm21b, were used to identify DH2 population that potentially contain the multiple Pm resistant genes. The results showed that four plants confer with Pm4b+ Pm12+ Pm21b, two plants with Pm4b+ Pm13+ Pm21b, one plant with Pm13+ Pm21b, four plants with Pm4b+Pm21b and four plants with Pm12+Pm21b, respectively. We will validate the plants with identified genes using gene-to-gene method and genetic analysis. These results will be useful for molecular marker-assisted breeding in wheat.

Key words: common wheat powdery mildew; gene-pyramid; DH population; molecular marker

Genomic Analysis of Plant Height with Molecular Marker in Maize

YAN Jianbing 1, TANG Hua 1, HUANG Yiqin 1, ZHENG Yonglian 1 and LI Jiansheng 1, 2,

1 National Key Lab of Crop Genetic Improvement, Huanzhong Agricultural University, Wuhan 430070

2 National Maize Improvement Center of China, China Agricultural University, Beijing 100094

Plant height is one of important agronomic traits. With the increase of planting density recently, selecting compatible heights of hybrids has been paid more attention during breeding. Alternatively, the rapid developments of the molecular markers provide powerful tools to localize QTLs involved in important agronomic traits at the whole genomic level. The purposes of this investigation are to map plant height QTLs with molecular markers and to analyze their genetic effects in maize. A F2:3 population from an elite hybrid (Zong3¡Á87-1) was utilized for evaluating plant heights in two locations, Wuhan and Xiangfan, in South China, using a randomized complete block design respectively. The mapping population included 266 F2:3 family lines. A genetic linkage map containing 150 SSR and 24 RFLP markers was constructed, which spanned a total of 2531.6 cM with an average interval of 14.5 cM. Totally 10 QTLs (LOD>2.5) affecting plant heights were mapped on 6 different chromosomes with the composite interval mapping. 7 of 10 QTLs were detected in two locations, all of which showed the same direction to increase plant heights, while 3 QTLs were detected only in one of the two locations. The contributions to phenotypic variations for the single QTL varied between 5.29% and 17.12%. Based on a comparison of partial linkage markers among maize and rice, it is presumed that 3 plant height QTLs, Ph1-3 and Ph5-2 in maize, and one linked to RZ403, might have a common origin. A large number of significant digenic interactions for plant height were detected by two-way analyses of variance. 107 and 98 two-locus combinations were found to be significant at the 0.01 probability level in 12,603 possible combinations, respectively, and 17 were simultaneously detected in both experimental locations. Some of the QTLs detected by single-locus analyses were involved in significant interactions, but most significant interactions occurred between non-QTL and non-QTL. These results demonstrated that epistatic interactions might play an important role in the genetic bases of maize plant height.

Key word: Maize Plant height; Molecular marker; Digenic interaction

Identification of Markers Linked to Resistance Locus of Marssonina Leaf Spot in Poplars by Bulked Segregant Analysis (BSA)

ZHANG Bo 1, HUANG Min-ren1£¬ZHUGE Qiang1£¬HAN Zheng-min1£¬YIN Tong-ming1£¬PAN Hui-xin1£¬ZHU Li-huang2£¬WU Rong-ling3 and WANG Ming-xiu1

1The Key Laboratory of Forest Tree Genetic Engineering, Nanjing Forestry University, Nanjing, 210037, China;

2The Institute of Genetics, Chinese Academy of Science, Beijing 100101, China;

3Department of Statistics,University of Florida,Gainesville, Florida 32611, USA

The genus Populus comprises about 30 woody perennial species of great economical and environmental value and is represented by such familiar trees as poplars, cottonwoods, and aspens. Populus has also been used as a model system for addressing biological questions related to recalcitrant forest trees with long generation intervals and outcrossing mating systems. The biological attributes of Populus as a model system in forest-tree biological includes rapid growth, rapid seed formation, small genome size (2C=1.2 pg), identical chromosome number of all species (2n=38), and efficient transformation system. It is especially the ease of vegetative propagation of individual Populus genotypes that greatly facilitates the estimates of quantitative and molecular genetic parameters. This plays an important role in bringing traditionally separate disciplines into an era of integrative biology.

Marssonina leaf spot of poplar is an important forest disease in China. Marssonina brunnea has been considered the most important of these pathogens because it occurs in most regions of China and has been associated with significant economic damage poplar plantation. The fungus causes very small, dark brown spots on leaves and petioles and sometimes on young green twigs and capsules. Poplar trees attacked by Marssonina display premature leaf fall and reduced photo -synthetic capacity and growth..

DNA markers linked to resistance locus of Marssonina leaf spot in poplars were found by bulked segregant analysis (BSA). The bulks consisted of individual with a extreme phenotype taken from a population of 91 F1 clones, which is a progeny of Populus deltoides Bartr. cv. ¡°Lux¡± (I¨D69/55) (Resistance) and P. euramericana cv. I¨D45 (Susceptible). Out of 114 RAPD primers, four markers showed polymorphisms between the resistance-bulk and the susceptible-bulk. By using selective genotype linkage analysis, OPAI17¨D1550 and OPAI13¨D900 were found linked to the resistance locus. The genetic distances between the two markers and the resistance locus were 29.9 cM and 37.4 cM, respectively.

Genetic Analysis and RAPD Markers of Genes Related to Morphological Traits in Soybeans

Fang HUANG, Deyue YU*, Tuanjie ZHAO, and Junyi GAI

Nanjing Agricultural University, Soybean Research Institute, National Center for Soybean Improvement, 210095, Nanjing, China (*For Correspondence: dyyu@njau.edu.cn)

Morphological traits are important for soybean improvement. In this study, several F2 populations were designed from parents with different morphological traits, among those, six traits were emphasized for genetic analysis using RIL populations, and RAPD markers linked with genes controlling brachytic stem and short petiole were discovered. Two traits (brachytic stem and fasciated stem) were analyzed with ¦Ö2 test in the genetic experiments. The result indicated that genotype for brachytic stem of NG94-156 could be estimated as sb1sb1sb2sb2, while normal stem genotype of NJ90L-2 to be Sb1Sb1sb2sb2 or sb1sb1Sb2Sb2, NJ87-23 and 963069 genotypes to be Sb1Sb1Sb2Sb2, respectively. Fasciated stem of T173 was controlled by a single recessive gene. And short petiole of Gongjiao 7622-4-1-4 is controlled by a single recessive gene as well. The genetic basis of other three traits (plant height, internode length, and leaf type) were analyzed using major gene and polygene mixed inheritance model. The results illustrated that these traits were suitable for two major genes and polygenes in most populations. However, the effect of polygenes was very little, which implicated that these traits are mainly controlled by major genes. In search for RAPD markers linked with brachytic stem trait, four parents of three combinations (88-31, 963069, NJ87-23, NG94-156) were firstly screened with 260 random primers, then RIL (from the cross between NG94-156 and 963069) were screened. Polymorphic bands revealed by the primer S-506 were the best repeated one among all tested primers. The genetic distance between S-5061600 and brachytic stem gene is 6.94cM. And the fragment S-5061600 was cloned and sequenced. For analyzing molecular markers linked with short petiole related gene, we screened 260 primers using BSA method and found six primers which could reveal polymorphic bands. However only the primer S-1 amplified polymorphic bands that were well tested by offspring analysis. The genetic distance between S-11900 and short petiole gene is 14.36cM. These results provided the basis for cloning genes related to plant architectures and for further study on molecular mechanism of plant development in soybeans.

Supported by National 973 program (G1998010206).

Study on the Biochemical and Molecular Markers of Waxy Protein in Wheat (Triticum aestivum L.)

Xu Zhaohua1, He Zhonghu1,2*, Xia Lanqin1 and Chen Xinmin1

1Institute of Crop Breeding and Cultivation, Chinese Academy of Agriculture Science, Beijing, 100081

2CIMMTY China Office, Beijing 100081

* author for correspondence email: zhhe@public3.bta.net.cn

Starch properties in common wheat are important factors influencing the noodle quality. Waxy proteins of more than 80 wheat varieties were screened through an improved 1-D SDS-PAGE method, 14 varieties were absent in Wx-B1 protein, one variety Kanto107 was absent in Wx-A1 and Wx-B1 proteins, and Baihuomai was absent in Wx-D1 protein. Fifty-eight waxy wheat lines were used to analyze the paste properties through the Rapid Viscosity Analyser (RVA).

The result showed that the averages of peak viscosity, breakdown and peak time are 208.8,115.7 and 3.8, respectively, while those of Kanto107, one of the parents, are 314.6,126.1 and 6.3, respectively. Similar to the results of other reports, major paste properties of waxy wheat lines are lower than their parents. Furthermore, a STS-marker and a SSR-marker were used to tag the waxy gene. A 440 bp band was obtained with the STS-marker if the Wx-B1 gene is normal, while a 265 bp band and a 204 bp band were amplified with the SSR-marker if the Wx-A1 and Wx-D1 genes are normal, respectively. The results show that the two markers are very useful to the molecular marker assisted noodle wheat breeding. Further researches are under a way in our lab. These studies will enable us to determine the composition of waxy proteins of the current major wheat varieties in China and have great significance in the assisted selection of wheat breeding.

¡¡

Mapping Quantitative Trait Loci Controlling Seedling Characteristics in Rice

Caiguo Xu, Yongzhong Xing, Yiwen Huang, Xiaoqin Li and Qifa Zhang

National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University

Rice seedling characteristics largely determines its grain yield. A better genetic understanding of the seedling characteristics in rice could be helpful to improve variety. In this study, a population of 240 recombinant inbred lines derived from a cross between Zhenshan 97 and Minghui 63 was used to identify QTLs for seedling characteristics. All materials were grown by hydroponic culture. Data for the following characters were collected at 25 and 35 days after germination: plant height (PH), tillers per plant (TP), shoot dry matter weight (SDW), root length (RL), number of root (NR), root dry weight (RDW) and the seedling character index (SCI, the ratio of SDW weight to PH). Analysis using composite interval mapping detected 15 QTLs for the seven traits of 25 days old seedlings, Zhenshan 97 alleles at fourteen of the QTLs increased trait values. The QTL in the vicinity of R3166 on chromosome 5 simultaneously influenced SDW, RL, NR, RDW and SCI with the same direction. Twenty four QTLs were detected for the seven traits of the 35 days old seedlings. However, Minghui 63 alleles at 13 of the QTLs increased trait values. The QTL linked to R3166 was also identified affecting the SDW, RL, NR and RDW. Only 5 QTLs were commonly detected at two stages. The QTL analysis also clearly indicated that Zhenshan 97 alleles offered positive effects in the first 25 days of seedling growth, while after that the positive effects of Minghui 63 alleles on seedling growth gradually became pronounced.

Molecular Dissection of Seedling Vigor and Associated Physiological Traits in Rice

K.H.Cui1, 2, S. B. Peng2, Y. Z. Xing1, C. G. Xu1, S. B. Yu1 and Qifa Zhang1

1National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China.

2Crop, Soil, and Water Science Division, International Rice Research Institute (IRRI), DAPO Box 7777, Metro Manila, Philippines.

Seedling vigor is important for crop establishment. There have been reported quantitative trait locus (QTL) analyses on seedling vigor-related morphological traits. However, physiological understanding of these detected QTLs is rather limited. In this study, we employed a population of 241 recombinant inbred lines£¬which derived from a cross between Zhenshan 97 and Minghui 63, to detect QTLs for seedling vigor traits and physiological traits related to seedling vigor in laboratory conditions using a mixed linear model approach.

Germination rate and seedling growth were measured to quantify seedling vigor. Total amylase activity, a-amylase activity, reducing sugar content, root activity, and seed weight were determined. Correlations were observed between the seedling vigor and physiological traits. A total of 31 QTLs were detected for the five seedling vigor traits, of which eight were for germination rate, eight for total dry weight, seven for shoot dry weight, four for root dry weight, and four for maximum root length, accounting for 54.7%, 58.0%, 52.7%, 47.5%, and 44.6% of phenotypic variations, respectively. Three QTLs were detected for total amylase activity, two for a-amylase activity, six for reducing sugar content, three for root activity, and nine for seed weight, explaining 20.5%, 14.4%, 51.9%, 27.2%, 64.9% of phenotypic variation, respectively.

Generally, QTL analysis reveals that the intervals of RG393-C1087-RZ403 on chromosome 3, C246- RM26-C1447 and R830- R3166-RG360-C734b on chromosome 5, and the interval of Waxy on chromosome 6 are the four main chromosomal regions controlling seedling vigor. Several QTLs for amylase activities, reducing sugar content, and root activity were localized in the similar regions as the QTLs for seedling vigor. The results suggest that these traits were under the control of pleiotropic and/or closely linked QTLs. In summary, the study demonstrated that QTL mapping for biochemical or metabolic characteristics might provide a strategy for analyzing the physiological basis of morphological trait variation. The co-localization of QTLs for seedling vigor and physiological characters may be considered as the explanation for the genetic basis of the correlation between the two sets of traits in rice.

Molecular Mapping QTLs Conferring Stay-green of Leaves in Rice

Gonghao Jiang *, Yuqing He and Qifa Zhang

National Key Laboratory of Crop Genetic Improvement, Huazhong Agriculture University, Wuhan 430070; *Corresponding author: jianggonghao@sina.com

Stay-green refers to a process in which yellowing was delayed for a longer time compared with a standard reference genotype. It often conferred plant some extra beneficial characteristics such as resistance to lodging, diseases, drought stress, etc. Stay-green of leaves can keep plants vigorous in photosynthesis during the later growth period, and therefore may lead to increase of yield. This study was intended to investigate QTLs for leaf stay-green traits in order to use them in rice to prolong the photosynthetic time. The materials included a population made up of 190 DH lines derived from the cross between an indica rice cultivar Zhenshan 97 and a japonica rice cultivar Wuyujing 2, the former yellowed rapidly and the latter yellowed slowly which was regarded a stay-green genotype. A total of 174 polymorphic SSR markers were used for constructing the genetic marker linkege map. The following observations were used as measurements for evaluating stay-green of the leaves: visual rate of green area retention (rgaf, rgas), retention of the green degree of the first and second leaf measured by SPAD-502 (rdgf, rdgs), retention of chlorophyll content (including rchlaf, rchlas, rchlbf, rchlbs, rchlf, rchls) for the first and second leaf at 30 d after heading, the date of flag (dfl) and second leaf (dsl) completely yellowed, and some other traits derived from the above measurements. A total of 52 QTLs, located on 2, 3, 4, 6, 7, 8, 9, 10 chromosomes, were detected for these traits. Many QTLs were overlapping with each other indicating the possibility that common pathways governed the different respects of senesce. The QTLs with relatively big effects included rchlbs1 located at RM324-RM301 on chromosome 2, rgaf1 located at RM82-RM125 on chromosome 7, dfy1, dsl1 located at RM125-RM2 on chromosome 7, dfy2, dsl2 at RM118-RM248 on chromosome 7, rrdgs1 (which related to the retention rate of the degree of the second leaf green derived from rdg/dg, where dg referred to the degree of leaf green measured by SPAD-502 at head date.) located at RM30-RM340 on chromosome 6. They explained 35.04%, 28.04%, 27.38%, 34.1%, 20.1%, 23.26% and 23.34% the phenotypic variations, respectively. The QTL located at RM125-RM2 also controlled heading date, plant height, the maturity date. These results were based on the data in 2001 and repeated experiment in 2002 was underway. The QTLs consistently detected in two years would be very meaningful for the improvement of stay-green traits.

QTL Analysis of Resistance to Disease Caused by Rhizoctonia cerealis

Huo Naxin and Jia Jizeng*

Institute of Crop Germplasm Resources, Chinese Academy of Agricultural Science; Key Laboratory of Crop Germplasm & Biotechnology, Ministry of Agriculture, Beijing, 100081, China

Wheat sharp eyespot caused by Rhizoctonia cerealis is one of the serious diseases in China, which has resulted in great loss of wheat grain yield. Immune variety has not been found in both cultivated wheat and related wild species. However, considerable variation exists among different wheat germplasm for quantitatively resistance to this fungus. To map and localize resistance QTLs associated with disease using quantitative trait loci (QTLs) analysis can contribute to providing theoretical guide to breeding for disease resistance and the basis on which molecular marker-assisted selection can be implemented.

In this study, two mapping populations were used to analyze QTLs associated with the resistance to R. Cerealis. The population of (Opata85¡ÁW7984) recombinant inbred lines was kindly provided by ITMI. Another population is (Wenmai6¡ÁShanhongmai) recombinant inbred lines which was cultured in this study. The marker genotype of this population was assessed with 112 wheat microsatellites and 97 AFLP markers. For the construction of the genetic map, linkage analysis was performed with the program MAPMAKER (Lander et al. 1987), and the map comprised 152 marker loci (3148 cM) with the average marker density of 20.7cM.

Through mixed-model composite interval mapping, six putative QTLs associated with seedling resistance to Rhizoctonia cerealis were detected in the population of (Opata85¡ÁW7984), totally accounted for 49.9% of phenotypic variation. Three putative QTLs associated with adult resistance to Rhizoctonia cerealis were detected in the population of (Opata85¡ÁW7984) and (Wenmai6¡ÁShanhongmai), respectively. In the prior population, the adult resistance QTL has the same interval with one of seedling resistance QTL located on 7B chromosome accounted for 19.11% of phenotypic variation. In the population of (Wenmai6¡ÁShanhongmai), one QTL under field environments was localized on 2B chromosome, accounted for 13.11% of phenotypic variation, derived from susceptible parent-Wenmai6, another QTL under greenhouse environments was localized on 6B chromosome, accounted for 14.34% of phenotypic variation, derived from resistant parent-Shanhongmai. Several significant digenic interactions associated with seedling and adult resistance were detected in two populations. It is shown that the epistatic effect is one of the main genetic factors contributed to the resistance to Rhizoctonia cerealis.

Key words: Wheat Sharp eyespot; QTL

¡¡

¡¡

Discovery of Tentative Gene Tags Associated with Male Fertility of Wheat Using SSH Strategy

Zhengzhi Zhang, Zhengqiang Ma*

National Key Lab of Crop Genetics and Germplasm Enhancement, Nanjing Agricultural University, Nanjing, Jiangsu 210095, P. R. China, *zqm2@njau.edu.cn

To identify genes associated with the occurrence of nuclear male sterility of wheat, cDNA suppression subtractive hybridization (SSH) was performed using RNA from anthers of sterile plants and fertile plants of near isogenic line (NIL) Yangmai5 carrying Ms2 gene. Using the SSH-PCR products, a subtractive library was constructed, from which 882 clones were collected. Colony and dot hybridization using cDNA revere-transcripted from RNA of fertile and sterile anther tissues as probes indicated that 92% of the clones were positive ones. Random sampling of 55 clones showed that the insert size of the clones ranged from 50 bp to 450 bp. 414 clones randomly picked out from the library were classified into 73 groups based on fingerprinting results. Thirteen inserts occurring in higher frequency were sequenced. Database search showed that 77% of them are probably Trticeae-specific sequence. Southern blot revealed that they are all single copy sequences in wheat genome, but showed no polymorphism between sterile and fertile plants. RNA dot blot using inserts of clones s36 and s294 as probes, which appeared in the highest frequency in the library, suggested they might be part of the genes specifically expressed in anther tissues. These clones were assigned to wheat chromosomes using wheat aneuploids and were also used to screen a cDNA library to isolate the full sequences of interest.

Preliminary Analysis of Gene Expression Profiles Induced by Water Stress in Wheat Seedling (Triticum aestivum L.)

Wang Zhuan1, Jing Rui-lian1, Chang Xiao-ping1, Jia Jin-ping2

1 Key Laboratory of Crop Germplasm & Biotechnology, Ministry of Agriculture, Institute of Crop Germplasm Resources, Chinese Academy of Agricultural Sciences, Beijing 100081,China

2 Shanxi Agricultural University, Taigu 030801, Shanxi, China

Corresponding author: jingrl@yahoo.com

Plant response to water stress is manifested by various changes in physiological and metabolic processes. The mechanisms of drought response have been investigated most extensively in model plant Arabidopsis, but a few in crops, especially in wheat. To identify genes those are co-regulated with known sets of genes and to uncover previously unknown genetic function in wheat, this study was designed to profile the expression pattern induced by water stress. To enrich differentially expressed sequence tags (ESTs) for water stress, cDNA subtraction library were generated including 1500 clones from water stressed leaves of wheat seedling. All cDNA inserts were amplified by PCR and the PCR products were micro-arrayed onto the nylon membrane with robot Qpix machine according to the method of Amersham Hybond-N+ Dot blotting DNA. The dots array membranes were hybridized with forward- and reverse- subtracted probes, respectively, which were labeled with [¦Á-32P] dCTP. 202 positive clones were selected from the library in primary screening. Among them, 32 clones were randomly chosen for sequencing. Database searches revealed that 11 cDNA clones are 94%-100% homologous with the EST sequences of wheat drought stressed leaf cDNA library Triticum aestivum cDNA clone, 3 cDNA clones have high homologous with the ESTs Hordeum vulgare seedling shoot EST library HVcDNA0002 (Dehydration stress), one has high homologous with Water-stressed 1 (WS1) Sorghum bicolor cDNA, one have high homologous with Drought stress (leaf) Oryza sativa cDNA clone, 2 have high homologous with Wheat ABA-treated embryo cDNA library Triticum aestivum cDNA clone 4 have high homologous with wheat salt-stressed or heat-stressed sheath cDNA library Triticum aestivum cDNA clone. The sequencing of the other clones is in progress.

Isolation and Characterization of Wheat NBS-LRR Like Gene Homology Sequence

Aili Li, Jizeng Jia

Key lab of Crop Germplasm & Biotechnology, Ministry of Agriculture, Institute of Crop Germplasm Resources, CAAS Beijing 100081

Powdery mildew caused by Erysiphe graminis DC is a severe wheat disease in China. Breeding for resistant cultivars has been proved the most effective way to control this disease, however, the comprehensive understanding of disease resistance genes is the premise. Up to now, 29 loci with 45 main effective genes were identified in wheat. They were located in different chromosomes respectively. Corresponding markers had already been found for some of them, but none of the resistance genes of wheat has successfully been cloned so far. In this thesis, NILs of different resistance genes, such as Pm2, Pm4a and Pm16, were used for cDNA synthesis. RT-PCR was performed using cDNA from these NILs as template, in addition, the primers were designed based on the conserved domains of known disease resistance genes. Furthermore, chromosomal localization and gene expression analyses were finished with some interesting cDNA clones. The followings were concluded: 1) Mlo, Mla and NBS-LRR like expressive gene sequences were isolated from wheat genome. Ten single nucleotide polymophisms (SNPs) between the R and S were found within the NBS-LRR. Fragment patterns was differentiated between the R and S plants with the primer pair based on the SNP158. Using nulli-tetrasomic lines of ¡°Chinese Spring¡±, the NBS-LRR like gene is located on 1D chromosome of wheat. Between control harvested just before inoculation and the material of PIH (post-inoculation hour) 72 using E. Graminis as pathogen, the obvious difference in mRNA splicing of this gene is observed, implying this gene may be involved in disease resistance of wheat. 2) A NBS-like gene, which is in the forms of genomic DNA clone and cDNA clone, was isolated from wheat genome. It showed 99% homology to the Cre3 gene. However, there was no difference found between the R and S plants. Whether this fragment is related to the disease resistance of wheat or not should be further testified. 3) One candidate gene sequence of ADP-ribosylation factor was isolated from wheat genome using primer pair of RPW81C. It showed 92% homology to the ADP-ribosylation factor gene from rice and 86% homology to the ADP-ribosylation factor gene from wheat.

Key Words: Triticum aestivum£¬mlo gene£¬NBS-LRR£¬RT-PCR£¬NIL£¬RGA

Cloning and Identification of Differentially Expressed Genes between Wheat Hybrid F1 and its Parental Inbreds in Flag Leaves

Wu Limin, Sun Qixin, Ni Zhongfu, Lin Zhan, Meng Fanrong and Xie Xiaodong

Crop Science College of China Agricultural University£¬100094£¬Beijing, China

*Corresponding author; e-mail:QXSUN62@public.bta.net.cn

The phenomenon of heterosis or hybrid vigor is poorly understood despite its perceived importance in evolution and its practical significance in breeding programs that aim to increase yield of crop plants. Previous studies have showed that gene expression in hybrid F1 alters obviously as compared to their parental inbreds, but for further elucidation of the molecular mechanism of heterosis, it should be to clone and identify the genes that differentially expressed between hybrid F1 and its parental inbreds.

By using differential display technique, thirty-one cDNA fragments that differentially expressed between heterotic wheat hybrid F1 (Nongda3338 ¡ÁJingdong6) and its parental inbreds were isolated, cloned and sequenced, in which 24 were confirmed by reverse-northern blot. Among the 24 differentially expressed genes, ten transcripts showed lower expression in hybrid F1; one was expressed only in both parents, not in F1; four were observed in only one parent, not in F1 and the other parent; two showed highly expression in F1; six were presented in one parent and F1, but absented in the other parent; and one was expressed in F1 and both parents, but the amount of expression in F1 was similar to that of in female, only a little was expressed in male. Homologous research in GenBank showed that 15 of 24 transcripts were not similar to any known gene; two transcripts had similarity to genes which were involved in the pathways of signal transduction, one is CaM binding protein, the other is EDR1 (enhanced disease resistance 1) protein; one was similar to RAPB (Rice HAP B subunit) transcription factor; two transcripts showed high similarity to NADH dehydrogenase (ubiquinone) and alpha-glucan phosphorylase, respectively; one transcript had a high similarity to the plant NBS-LRR type resistance protein; two transcripts had high similarity to transposon or non-LTR retroelement; and one showed high similarity to twitching motility protein.

The above results indicated that heterosis is a complex biology phenomenon, and many kinds of genes may participate in its developing. Therefore, the further study will be to fish the full-length cDNAs of gene expression alteration and analyze their detailed function.

Key words: wheat, heterosis; DDRT-PCR; molecular mechanism.

Differential Display of Badila Infected SCMV (Sugarcane Mosaic Virus)

DAN Yan and PAN Daren

key Lab of Sugarcane Genetics & Breedings Ministry of Agriculture P.C.R , Fuzhou 350002

Badila which was virus free by way of tissue culture and Badila infected SCMV were studied by DD (Differential display), a set of flouresent DD operating method was founded.9 differentially expressed cDNA fragments were obtained by this set of operating method and selected 23 primer combinations. The size of 9 fragments was between 250 bp and 350 bp. These fragments were grouped into two types: 4 differentially expressed cDNA fragments which exist or not in the two compared experimental materials; 5 differentially expressed cDNA fragments which had the intensity difference between the two compared experimental materials. 5 fragments were obtained from Badila which was virus free, and 4 fragments were obtained from Badila infected SCMV.The 9 fragments were amplified by agarose gel again and had the same size as the fragments in the fluoresent DD Gel. Some influence factors of DD were discussed.

Cloning, Sequencing and Expression Analysis of Pina and Pinb Genes Controlling Grain Hardness in Common Wheat

Lanqin Xia1, Zhonghu He1,2, Xinmin Chen1, Qingzhu Zhang1 and Yang Zhou1

1The Institute of Crop Breeding and cultivation, Chinese Academy of Agricultural Sciences, The National Wheat Improvement Center, Beijing 100081; 2 CIMMYT China Office, Beijing 100081

Grain hardness is one of the most important characters in wheat quality improvement. Based on the homologues of Pina and Pinb gene, which are major genes controlling the grain hardness in cereal crops, two pairs of degenerate primers were designed. The specific fragments of about 450bp in size were obtained, respectively, after PCR amplification using the genomic DNA of wheat variety Jing411 as template. Then they were cloned into vector pGEM-3Z f(+), and sequenced after the identification of the recombinants and endonuclease analysis. The results indicated that, compared with the Pina gene from wheat variety Heron, the Pina gene in Jing411 shared 98.9% and 98% homology in nucleotide acid sequence and amino acid sequence, respectively. The whole length of Pina gene was 447bp, encoding 149 amino acid residues, having the signal peptide of 19aa and the tryptophan-rich domain (WWKWWK) which are specific to Pina gene in cereal crops. Similarly, the Pinb gene shared 99.8% and 99.3% homologies in nucleotide acid sequence and amino acid sequence respectively compared with the cloned Pinb gene in soft wheat variety Heron. The whole length of Pinb gene was 447bp,encoding 149 amino acid residues, having the signal peptide of 19aa and the tryptophan-rich domain (KWWK) which were specific to Pinb gene in cereal crops. The isolation of Pina and Pinb genes laid a fundamental basis for further improvement of the grain hardness of wheat variety through genetic engineering. At present, these two genes have been constructed into the bacterial expression vector and expressed in the E coli (BL21). Construction of the high efficient monocot plants expression vector harboring these two genes, its antisense genes and the fusions of these two genes and wheat transformation via pollen tube pathway and biolastic mediated transfer of these genes are under way.

Key words: Wheat; Grain hardness; Gene cloning; Tryptophan-rich domain

Cloning and Analysis of Lox in Embryos of Oryza sativa L.

Shen Wenbiao, Wang Ren, Wang Yihua, Wan Jianlin, Zhai Huqu and Wan Jianmin*

State Key laboratory of crop genetics and germplasm enhancement, Nanjing Agricultural University, Nanjing 210095, China; *Correspondence author: E-mail: wanjm@mail.njau.edu.cn

In rice embryos, LOX-3 accounted for 80-90% totally LOX activity in rice embryo. In 1993, a Thai rice variety ¡°Daw Dam¡± lacking LOX-3 isozyme was found. Further results indicated that the lack of LOX-3 in Daw Dam led to decrease lipid oxidation during the rice storage, alleviate the accumulation of carbonyl compounds, such as hexanal, pentanal and pentanol et al, both of which could keep the fresh flavor without deterioration in rice grain and development of a stale flavor during storage. Until now, four Lox genes in rice leaves have been cloned, also classified two classes based on the presence or absent of a transit peptide. However, these four above genes can not be contributed to the embryo Lox gene by comparing these nucleotide and its encoded amino acid sequences, biochemical characterization of these expression products with known LOXs in rice embryo. The overall objective of our study was to clone all Loxs in embryos of Koshihikari after flowering, the most popular rice cultivar having normal LOX-3 activity, in order to compare with those of Daw Dam and elucidate the molecular mechanism of lipoxygenase null genotype related to rice storability in the nearly future.

Based on the conserved HAAVNFGQY and GIPNSI(T)SI amino acid sequence motifs in the C-terminal region of the known LOXs in plant kingdom obtained from GenBank database, RT-PCR using the degenerate oligonucleotide 5¡ä-CAY GCN GCN GTN AAY TTY GGN CAR TAY- 3¡äas the forward primer and a reverse primer (5¡ä-DAT NSW NRT NSW RTT NGG NAY NCC - 3¡ä) was designed for cloning of the 3¡äcDNA end of Lox in embryos of Koshihikari. One of the PCR products, appeared in the embryos 5-15 DAF, was cut out. Subsequently the cDNA was eluted from the gel and cloned into the pGEMTeasy vector (Promega, Madison,USA). DNA sequencing and analyzing through Internet BLAST searching showed this clone (named loxE1), deduced amino acid sequence of which shared 55~65% identical to the published sequence of LOX obtained from the leaves of rice and the embryo of soybean, was a novel Lox gene fragment.

loxE1 transcript levels in various tissues, such as embryo, stem and leaves, were investigated by Northern blot analysis of total RNA samples. The results showed loxE1 conferred embryo-specific expression pattern. On the other side, southern blot analysis was performed using above loxE1 as probe. Several bands of strong intensity were observed with three different restriction enzymes, indicating that several other Lox family members occur in rice.

Agrobacterium-Mediated Transformation of Maize with the Help of Bomdbardment

Rong zhang and Guoying Wang *

National Key Lab for Agrobiotechnology, China Agricultural University, Beijing 100094, China

* Corresponding author. Email: gywang@mail.cau.edu.cn

After bomdbardmented with genegun immature embryos of maize inbred Z3¡¢Z31 were transformed by Agrobacterium tumefaciens LBA4404:pTOK233¡¢LBA4404:pAt5. Resistant calli frequency is 40%. While without bomdbardment, A. tumefaciens LBA4404:pTOK233¡¢LBA4404:pAt5 is used for transformation, resistant calli produced frequency of maize inbred Z3¡¢Z31 is 25%. Plants were regenerated from the resistant calli. PCR of regenerated plants indicated that foreign gene had integrated into maize genome calli. Microwounding by means of microbombardment of the scutella with gold particles, the transformation frequency have been raised greatly.

Embryogenic calli of maize inbred Z3¡¢Z31¡¢Q31¡¢P9-10 cann¡¯t be transformed by A. tumefaciens, only TYPE calli of genotype F can be transformed by A. tumefaciens. A. tumefaciens LBA4404:pTOK233¡¢LBA4404:pAt5¡¢ LBA4404:p3301 was introduced into maize calli with help of bombardment. After two months selection, resistant calli produced frequency is 11.8%. Plants were regenerated from the resistant calli. PCR of regenerated plants indicated that foreign gene had integrated into maize genome.

Cloning and Expression Analysis of R Gene Candidates in Soybeans

Yongjun Wang, Chaoying He, Bangjun Wang, Jinsong Zhang and Shouyi Chen

Institute of Genetics and developmental Biology, Chinese Academy of Sciences, Beijing

The majority of R genes are the type of nucleotide binding site-leucine rich repeat (NBS-LRR). The conserved motifs in NBS domain had been used to isolate resistance gene analogs (RGAs) from soybeans and other plants. In the present study, The RGAs were used to clone R gene candidates from Kefeng 1, a soybean cultivar resistant to soybean mosaic virus (SMV) and soybean cyst nematode (SCN).

The oligonucleotide primers were designed according to the tobacco R gene N and Arabidopsis R gene RPS2. The PCR products from Kefeng 1 were cloned and 358 positive clones were isolated. Four open-reading NBS analogs were finally characterized and designated as KNBS1, KNBS2, KNBS3 and KNBS4.

In order to clone R genes from soybean, a high titer of soybean cDNA library (4.2´ 107Pfu/mL) was constructed. The library was screened using the mixed probes of the resistance analogs mentioned above. Four positive clones were obtained, which were designated as KR1 , KR2, KR3 and KR4.

The length of KR1 was 3672bp with a complete open reading frame encoding a protein of 1124 amino acids which consisted of a Toll/Interluekin receptor (TIR) domain, a nucleotide binding site (NBS) domain, a leucine-rich repeats (LRR) domain and two C-terminal transmembrane segments. The KR1-related sequences were present as 2-4 copies within the soybean genome and two of them were mapped onto L linkage group. The transcripts of KR1 gene were detected in roots, hypocotyls, cotyledons, epicotyls and leaves. The gene appeared to be induced by salicylic acid treatment and soybean mosaic virus infection. Like N and L6, the KR1 gene gave rise to two mRNAs via alternative splicing. The larger one (KR1, 609bp) was unique transcript in resistance parent (Kefeng1); the smaller one (NR1tr, 588bp) that aroused via alternative splicing was predominant in susceptible cultivar Nannnong1138-2 under normal condition. When the plants were inoculated with SMV, the transcripts were all accumulated positively in both parents but the ratio of NR1/NR1tr transcripts was reversed in susceptible parent . These results demonstrated that KR1 is possiblely a functional resistance gene in infection of soybean mosaic virus and mediated by salicylic acid.

The KR2 , KR3 and KR4 were incomlete ORFs. Using 5¡¯ RACE, the whole sequences of KR3 and KR4 were acquired. KR3 (AF502079) was 2,353 bp in length including a 41 bp poly-A tail, and encoded a protein of 636 amino acids. Structural analysis revealed that it had conserved motifs of R genes such as TIR and NBS, but no LRR domain. KR3 shared 28.1% amino acid sequence identity with N, suggesting that they might arise from close ancestral genes before speciation. Southern blot analysis showed that KR3 was probably in single- or low-copy numbers in soybean genome. Under normal condition, KR3 was expressed in a relatively low level in soybean leaf. However, application of 2.0 mmol/L SA to the plants resulted in accumulating of KR3 mRNA. The mRNA level reached a peak at 36 h after initiation of the SA treatment and then began to decline.

KR4 (AF502079) was 3,818 bp in length encoding a protein of 1211 amino acids. It had only conserved motifs of NBS and shared 16.0% amino acid sequence identity with Xa1 of rice.

A Novel Lipid Transfer Protein-Like Antifungal Peptide from the Seeds of Leonurus heterophyllus Sweet1

Yang Xingyong, Yuan Xiaohong, Xiao Yuehua, Zhen Changyong, Zhang Yongjun and Pei Yan*

Biotechnology Research Center, Southwest Agricultural University, 400716 Chongqing

* corresponding addressed. E-mail: biotech@swau.cq.cn

Leonurus hereterophyllus Sweet (Motherwort), a member of the family Labiatae, is a traditional Chinese herbal medicine used to treat menstrual disturbances in woman. Its various pharmacological effects, including anti-platelet activating factor action, antimicrobial activity, suppressing mammary tumours growth, antioxidant and stimulating action on the uterus, have been reported. In searching for antifungal proteins from various sources, we found that motherwort seeds contained strong activity against growth of some fungi. We report the isolation and characterization of an active antifungal peptide, designated as heterophyllin, from motherwort seeds.

The purification procedure of involved extraction, ion exchange chromatography on CM-Sepharose, reverse-phase HPLC Spherisorb C8 column and reverse-phase HPLC on Aquapore OD-300 C18 column. The heterophyllin are basic with a pI of 8.74 and consist of 58 amino acid residues with a molecular weight of 5843.93 Da. Database search indicated that heterophyllin has high homology to those of lipid transfer protein (Fig 1). Heterophyllin possessed antifungal activity against Fusarium culmorum, Trichoderma harzianum, Aspergillus niger and Botrytis sp. but not against Alternaria solani.

Capsicum annuum ---MEMVGKIACVVLLCMVVVAPHAEALTCGQVQSRMTPCLPYLTGSGPLG-RCCGGVK

Nicotiana tabacum ----MEMVSKIACFVVLCMVVVAPHAEALTCGQVQSSLAPCVPYLLGRGPLG-GCCGGVK

Avicennia marina MEGMNKSMCIIVVVAVLAAWVVPHGEAAISCGTVASKLAPCIPYVTNRGPLG-GCCGGVK

Leonurus hereterophyllus ---------------------------AIGCNTVASKMAPCLPYVTGKGPLG-GCCGGVK

Prunus dulcis --MAYSAMTKLALVVALCMVVSVPIAQAITCGQVSSNLAPCIPYVRGGGAVPPACCNGIR

Capsicum annuum GLLGAAKTPADRKTVCSCLKSAAGSIGGINVRKAAGLPNMCGVNIPYQISPSTDCTKVQ

Nicotiana tabacum RLLGAARTPADRKTACNCLKSAANTFKGIDMGNAARLPGTCGVNIPYKISPSTDCSKVQ

Avicennia marina SLYGLARTTPDRQSVCGCLKSLASSYN-VNLGKAAGLPGQCGVNIPYKISPSTDCSKVH

Leonurus hereterophyllus GLIDAARTTPDRQAVCNCLKTLAKSY---------------------------------

Prunus dulcis NVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVNIPYQISPSTNCANVK

Fig. 1 Comparision of Heterophyllin with some lipid transfer proteins

1 This research was pertially supported by a grant from the Ministry of Science and Technology of P. R. China.

Cloning and Characterization of a Chitinase cDNA from Momordica charantia1

PEI Yan*, XiaoYue-Hua, Hou Lei, Pei Ying, Yang Xin-Yong and Luo Xiao-Ying

Biotechnology Research Center, Southwest Agricultural University, Chongqing, Beibei,400716, China

Corresponding author: E-mail: peiyan@swau.edu.cn

Balsampear (Momordica charantia) is a vegetable crop with high resistance to both pathogens and pests. As a part of investigation on molecular basis of M. charantia defense system, a chitinase was purified from leaves and its N-terminal was sequenced. Then rapid amplification of cDNA ends (RACE) technique was employed for the chitinase gene cloning. A 1062bp length fragment, containing a coding region of 882bp, was obtained by RACE. The predicted mature protein is composed of 294 amino acids, and its N-terminal sequence is identical to the sequence data obtained from purified protein. The molecular mass of the predicated protein is 31,953 Dalton, and its isoelectric point is 8.1, corresponding with the protein properties of purified chitinase previously reported. Taken together, the results point out that this cDNA (named Chit-Mc) encodes the same chitinase that we purified from M. charantia leaves. Alignment analysis on the protein level shows that Chit-Mc shares high similarity with a pumpkin chitinase, Chit-Cu (81%). There are two conserved regions in the mature chitinase, the chitin binding domain (Q2-C39) and the chitin catalysis domain£¨I57-F293£©, both of which exist in the typical class I chitinase. Taken these data together, we grouped the Chit-Mc into class I chitinases of plants.

Key words: Momordica charantia; chitinase; gene cloning

1Supported by the National Transgenic Plant Plan (ZJY-A-01)

Cloning and Sequence Analysis of a Steroid 5¦¡Reductase Gene from Cotton (Gossypium hirsuturm L.) Fiber

LUO Ming, XIAO Yue-hua, HOU Lei, FANG Wei-gou, LUO Xiao-ying , ZHANG Zheng-sheng, ZHENG Shang-yong and PEI Yan¢Ù

Biotechnology Research Center, Southwest Agricultural University£¬Chongqing 400716£¬China

*Corresponding author, E-mail, peiyan@swau.edu.cn; Tel, 86-023-68251883

Brassinosteroids (BRs) are natural growth-promoting products found at low levels in pollen, seeds, and young vegatative tissues throughout the plant kingdom. Recently, the notion that BRs are essential for plant growth and development has been widely accepted by the discovery of BR dwarf mutants of Arabidopsis, pea and tomato. The observation that only BRs could rescue the mutant phenotypes to the wild type provided convincing evidence that BRs are indeed essential plant hormones for normal plant growth and development. Cell elongation is developmental process that is regulated by light and phytohormones and is of critical importance for plant growth. The dwarfed phenotype results from a failure in normal cell elongation. The cells of BR dwarf mutants are far shorter than the corresponding wild-type cells. Furthermore, exogenous application of BRs could elongate the cells and rescue the dwarfed phontype. These confirmed the role of BRs in cell elongation. However, the mechanisms of BRs acting on cell elongation, especially in cotton (Gossypium hirsutum) fiber development are largely unknown. The fibers of cotton are single-cell trichomes that result from elongation of epidermal cells of the ovule and undergo rapid and synchronous elongation. Because the longation occurs at a fast rate over a relatively long period, uninterrupted by cell division, The fibers of cotton are a good experimental system for studying cell elongation. In addition, changes in the cell wall structure of elongating cotton fibers have been well characterized.

To understand the roles and mechanisms of BRs in cotton fiber elongation and to regulate the level of endogenous phytohormones by using the gene of biosynthetic pathway of hormone, we have screened the EST database of cotton fiber using steroid 5¦Áreductase DET2 gene (Arabidopsis thaliana), which is the key gene on the biosynthetic pathway of brassinosteroid. Based on a contig sequence that results from three EST fragments, we amplified a 645-bp fragment. A fiber cDNA library of Xu Zhou 142 (Gossypium hirsutum ) was screened using this amplified fragment as probe. We obtained a clone (GhDET2), which contains 996 base pairs and a single, long open reading frame that encodes a 248-amino acid protein. BLAST analysis demonstrated that the deduced polypeptide was homologous to Arabidopsis DET2p with the sequence identity of 72% and the similarity of 89%, and mammalian steroid 5¦Áreductase with the identity of 36 to 42% respectively. Phylogenetic analysis shows that GhDET2 is very closely related to Arabidopsis DET2.

Funded by the National Natural Science Foundation of China (Grant No. 30170588 )

Cloning and Expression Analysis of A LIM-domain Protein Gene From Cotton (Gossypium hirsuturm L.)

LUO Ming, XIAO Yue-hua, ZHANG Zheng-sheng, FANG Wei-gou, HOU Lei, LUO Xiao-ying, ZHENG Shang-yong and PEI Yan*

Biotechnology Research Center, Southwest Agricultural University£¬Chongqing 400716£¬China

*Corresponding author, E-mail, peiyan@swau.edu.cn; Tel, 86-023-68251883

LIM-domain proteins are implicated in multiple cellular and developmental processes in eukaryotes. Their essential roles have been well characterized in animals. It was revealed that LIM-domain protein plays an important role in various cellular processes, including construction of cytoskeleton, transcription control and signal transduction. However, only a few members of this protein family have been identified from plants, and the function of LIM-domain protein in plants is largely unknown. Since LIM-domain protein of plants are structurally related to the animal muscle proteins CRP1, CRP2 and CRP3, which are essential components in the organization of the actin cytoskeleton, particularly at the sites of membrane adhesion. CRP1, CRP2 and CRP3 have been shown to bind the cytoskeletal proteins zyxin and ¦Á¨Cactinin, two important regulators of actin cytoskeletal organization. Plant LIM-domain proteins may have similar functions in plant cell. Cytoskeleton plays an important role in the plant developmental processes by regulating the direction of the cell elongation. But the understanding of the mechanism is limited.

The fiber cells of cotton (Gossypium Hirsuturm L.) represent a unique cell type that undergoes a period of very rapid elongation. Fiber cells are also single-celled trichomes, which arise in near synchrony from the epidermis of the ovule and may elongate at peak rates in excess of 2mm d-1 during the rapid polar-expansion phase of development. So the cotton fibers are a good experimental system for studying cell elongation.

Based on cotton fiber EST database and contig analysis, the coding region of a cotton LIM-domain protein gene (GhLIM1) was obtained by RT-PCR from cotton 4DPA (day post anthesis) ovule (with fibers). The cloned fragment of 848 bp contains an open reading frame of 570 bp, coding a polypeptide of 189 amino acids. It was demonstrated that the deduced GhLIM1 protein was highly homologous to the LIM-domain protein of Sunflower (Helianthus annuus) with the sequence identity of 71%, Tobacco (Nicotiana tabacum) with the sequence identity of 89.9% and Arabidopsis thaliana with the sequence identity of 76%. Furthermore, same as the other plant LIM-domain protein, GhLIM1 also contains four regions, a short N-terminus (nine residues), two 52-residues LIM domains separated by a 50-residues spacer region, and a short C-terminal region (only 30 residues). Particularly, two intact LIM-domains, with the conserved sequence of double zinc-finger structure (C-X2-C-X17~19-H-X2-C-X2-C-X2-C-X16~24-C-X2

-H), were found in the GhLIM1 protein. But the cotton, sunflower, tobacco, and Arabidopsis proteins show the same amino acid residues different with the animal CRP proteins. First, the last zinc ligand in each of the LIM domains is a histidine (h), while it is a cystein (c) in the animal proteins. Secondly, the plant proteins have an unusual second LIM domain. RT-PCR analysis showed that GhLIM1 gene expressed in root, hypocotyls, leaf, anther and fiber (4DPA, 12DPA, 18DPA). It was proposed that GhLIM1 gene would be crucial for cotton fiber development.

Funded by the National Natural Science Foundation of China (Grant No. 30170588 )

Isolation and Characterization the ADP-Ribosylation Factor (ARF) Gene from Cotton Anther

Hou Lei, Luo Xiaoying, Wang Wenfeng, Xiao Yuehua, Yang Xingyong and Pei Yan*

Biotechnology Research Center, Southwest Agricultural University, Chongqing, 400716, China

*Corresponding author, E-mail, peiyan@swau.edu.cn; Tel, 86-023-68251883

ADP-ribosylation factor£¨ARF£©is considered as the family of small GTP binding proteins, with molecular mass around 21KD. It has been known that ARF plays important roles in cells to regulate membrane traffic and structure and intracellular signal transduction system in yeast and mammalian. Although ARFs have been uncovered in several plants in recent years, the function of plant ARFs remains poorly understood. We isolated a fragment from mRNA differential display in developing anther between a upland cotton (Gossypium hirsutum L) male sterile line and its sibling fertile line of ¡°Dong-A¡±, then we cloned a gene from cotton anther cDNA library by use of this fragment as probe. The predicated product of this cDNA is related to the ARF,

The positive clone was obtained by GHA27 as probe to screen cDNA library of cotton anther. Sequencing results indicated that this 828bp clone contained a 546bp length of open reading frame (position131-676 ) encoding a polypeptide of 181amino acids with a predicted molecular mass of 20.7KD. Sequence comparison of these positive clones with proteins in GeneBank, EMBL, DDBJ and PDB databases revealed a high amino acid sequence identity to ARFs of yeast, mammalians and other plants. This gene isolated from cotton anther putatively encoding ARF was designated as GhARF (Accession No. AJ421017). Several conservative motifs, P (GLDAAGKT), G (NKQDL), G¡¯ (DVGGQ), which are present in the other known ARF proteins as involved in GTP binding motifs, could be also recognized in the GhARF. On the nucleotide level, GhARF showed 86%, 84%, 83% identity to the ARFs in Arabidopsis, soybean and wheat respectively. On the protein level, Similarity comparison of GhARF revealed high identity to Arabidopsis and pepper (99%), and to wheat and rice (98%) respectively, indicating that ARF are very conservative in plant kingdom. Probing of a southern blot of genomic DNA digested with EcoR¢ñ, EcoR¢õ, Kpn¢ñ(enzymes that do not cut inside the prob) by GHA27 that contained 440bp coding region identified 1 or 2 major and a few minor bands. The hybridization pattern indicated that a few copies of the ARF genes are present in the cotton nuclear genome. To determine the expression pattern of GhARF gene by RNA dot blotting, the results showed that GhARF transcripts accumulated in anther, pollen and corolla, but not in leaf, root and ovule. It was weakly detectable in pollen and the amount increased in corolla and anther which are at meiosis and microspore stages. To our knowledge, this is the first report of specificity of ARF in anther, pollen and corolla. The function of GhARF in cotton floral development is under investigation.

Funded by the National Natural Science Foundation of China (Grant No. 39870532 )

YADE, a New Method for PCR Walking of Genomic DNA and cDNA in Cotton

Xiao Yue-Hua, Luo Ming, Zheng Shang-Yong, Fang Wei-Guo, Hou Lei and Pei Yan*

Biotechnology Research Center, Southwest Agricultural University, Chongqing, 400716

*Corresponding author, E-mail, peiyan@swau.edu.cn; Tel, 86-023-68251883

The isolation of flanking sequences is a crucial step in the study of gene cloning and expression. On the basis of Y-shaped adaptor (Prashar and Weissman, 1996), we designed a new method which could be used to amplify the flanking region from both genomic DNA and cDNA. This method was designated as Y-shaped adaptor dependent extesion (YADE). The schematic of this method is showed in Fig.1.

Using this method, the 5? flanking region of gibberellin 20-oxidase gene (ga20) and sucrose synthase gene (susy) were successfully isolated from cotton (Gossypium hirsutum). Firstly, the genomic 5? fragment of the two genes was amplified by two pairs of primers designed according to the susy cDNA and an EST with sequence similarity to the Arabidopsis thialiana GA 20-oxidase, respectively. Then two nested primers were synthesized and used to amplify the corresponding 5? flanking region. The amplified fragments for ga20 gene was 1327 bp in length, containing 1249 bp upstream to the putative start codon and 50bp overlapped with the EST. The amplified 5? flanking region of susy gene was 1739bp with a 1583bp stretch upstream to the start codon, and the overlapping sequence with the cDNA gene was 89bp. Mutiple light response elememts were detected in the amplified flanking regions. To study the expression character, the two amplified 5? flanking regions have been fused to a GUS gene, and the further transformation and detections were in progress.

YADE method was also employed in rapid amplification of cDNA ends (RACE). With this method, the 3¡äand 5¡äterminals of most of cDNA species present in the sample can be amplified from a single reaction of cDNA synthesis. The 3¡äand/or 5¡äcDNA ends of 4 differential cDNA-AFLP fragments (F027, F010, 01005 and 01068) from cotton ovules and a chitinase-like gene from balsampear, Momordica charancia, were successfully amplified. Sequence alignment demonstrated that the two F027 fragments obtained by YADE, although several-base shorter in the ultimate terminal than those amplified by RACE kits (TaKaRa), could be joined to gain the complete coding region. Further amplifying the ORFs with the primers designed according to the YADE products showed that this method was a reliable method to isolate cDNA genes.

ffd8ffe000104a46494600010101012c012c0000ffdb004300080606070605080707070909080a0c140d0c0b0b0c1912130f141d1a1f1e1d1a1c1c20242e2720222c231c1c2837292c30313434341f27393d38323c2e333432ffdb0043010909090c0b0c180d0d1832211c213232323232323232323232323232323232323232323232323232323232323232323232323232323232323232323232323232ffc00011080220016403012200021101031101ffc4001f0000010501010101010100000000000000000102030405060708090a0bffc400b5100002010303020403050504040000017d01020300041105122131410613516107227114328191a1082342b1c11552d1f02433627282090a161718191a25262728292a3435363738393a434445464748494a535455565758595a636465666768696a737475767778797a838485868788898a92939495969798999aa2a3a4a5a6a7a8a9aab2b3b4b5b6b7b8b9bac2c3c4c5c6c7c8c9cad2d3d4d5d6d7d8d9dae1e2e3e4e5e6e7e8e9eaf1f2f3f4f5f6f7f8f9faffc4001f0100030101010101010101010000000000000102030405060708090a0bffc400b51100020102040403040705040400010277000102031104052131061241510761711322328108144291a1b1c109233352f0156272d10a162434e125f11718191a262728292a35363738393a434445464748494a535455565758595a636465666768696a737475767778797a82838485868788898a92939495969798999aa2a3a4a5a6a7a8a9aab2b3b4b5b6b7b8b9bac2c3c4c5c6c7c8c9cad2d3d4d5d6d7d8d9dae2e3e4e5e6e7e8e9eaf2f3f4f5f6f7f8f9faffda000c03010002110311003f00f7fa28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a293e945002d1451400514521e78238a005a01cd252818e9400514514005145140051451400514514005145140051451400514514008ccabd481f534df3a3c67cc4ff00be85636b7e0ef0f788ee63b9d634b86ee68d3623c99c85ce71c1f53594df0abc0ee727c3b6b9f6671fd6803aff003108c875c7d694329e8c3f3ae38fc28f03b000f87e0ffbf8ff00fc5530fc24f029ebe1e83fefec9ffc5500769b97d45191eb5c49f843e043ff0032fc7f84f2ff00f15487e0f78089e7404ffc099bff008ba00ee28c8ae1bfe14f780f047f608ffc0a9bff008ba53f07fc0673ff001211cfa5d4dffc5d007714570bff000a73c07ff40238f4fb64ff00fc5d1ff0a77c078c7f619ffc0c9fff008ba00eea8ae13fe14df80f9ff891b7fe06cfff00c5d1ff000a6fc079cff62bff00e06cff00fc5d00777914647ad70a3e0ef814631a3c800f4be9ff00f8ba07c1ef0386cff64cb9ff00afe9ff00f8ba00eea8ae1d3e11782d01034db8e7affa7dc7ff0017522fc29f0820216c6ec67d351b9ffe39401da515c67fc2acf0a608fb3dfe0f6fed3b9ffe39487e15f85760516f7e00f4d4ae3ff8ba00ed28ae307c2ef0c80004d48007381a9dc7ff00174e4f865e1c4185fed4e0607fc4d2e38ffc7e803b1a2b8d3f0cbc3e79f375704f52355b8e7ff1fa5ff8567a0ee0de7eb1b81c83fdab7191ff008fd00761900519ae40fc37d1c838bed7013c8ff89b5c71ff008fd03e1c69239fed2d7f3ebfdaf3e7ff0042a00ebe8c8071dfd2b8eff8571a77fd063c45e98fed79ff00f8aa3fe15cd867275cf1267d7fb5e6ff001a00eca8ae30fc37b3fe1f10f89d47a0d5e4ae9f4ad35349d361b18ee2eae16204092ea632c8d924f2c793d7f2c0a00b98a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2803135ad76f74ab88e2b6f0eea7a9ab26e32da18b6a9cfdd3b9c1cf7e9deb2ffe133d53fe847d7fff00207ff1caebe8a00e3cf8d3531c0f03f8809fa41ffc7281e36d44827fe107f117fdf107ff001caec28a00e40f8d751001ff008423c45ff7c427ff006a547ff09e5ee48ff841fc4dc73fea22e9ff007f2bb3a28038bff84fee86777823c53f85ac67ff006a507e20ce07fc893e2bff00c024ff00e395da51401c50f8853119ff008427c57ff8049ffc5d37fe162c9807fe109f16e0ff00d382ff00f175dbd1401c51f88ac396f0678b40f5fece07f93d37fe163fcc07fc21be2ee467234cff00ecabb7aa3ac6ad69a169173aa5fbb25adb26f90aa9638f602803951f1241ce7c1be301ff0070a3ff00c5527fc2cb4ddb7fe10ef17e7fec167ff8aaedd1d5d15d4e558641f514ea00e19be25aa9e3c1de2e3edfd9647f5a55f89711193e11f1729c67074a6cff003aee28a00e1bfe166dbed07fe114f16f3d07f64bff008d3c7c4bb52bb8f863c5601e99d224e6bb6a4a00e25be26590cffc53be28ff00c144947fc2ccb2ff00a16fc53ff82892bb7a28038b3f12b4f032741f12839c63fb265ff0ff0039a3fe16569a3ef68be235fae932ff00857698c0c51401c62fc4ad28f1fd95e201ee74998ffecb47fc2cad27033a66be327073a4cfc7fe3b5d9d1d28038d1f12b4663ff1e5ae01ebfd953fff00134bff000b2b450c41b4d6801dce953e3ff41aec68a00e37fe167787d7efc7aba8ce3e6d2ae3ff0088ae9f4bd4adf57d3a1bfb5f37c89412be6c4d1b7048e558023a7a55ba2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800ef45273b8f236e3818a5a0028a28a0028a28a0028a28a0028a28a002b8ff008a8e13e18eba4e31e401c8f57515d857ccdf13be27f8a84bacf83754b0d3a28c3f96d2c48e19932191865c8191b4f7eb401f4ac23f709d47ca2a4af1af855f13fc4fe3af10bd8dc69fa7c5a75b425e79a28e4c8ecaa0962324f3f4535ec9400b457905deb9e244f11f8cad7fe1333656da2470cb6e6ead202ae5d379572101c646d18e79ee6babf0bf8e92f7e1ee9fe23f1004b29273e5954466f35f7955d880163bb190064fd6803b4a2b985f883e1a6d392f16fddd5ae0daf9496d29984c01250c41778200279159175f167c3f1ea7a3dadab5c5cc3a89918ccb6d280888181206dcb1deb8c01c0c938ee01df515c1de7c53f07ddc17d6367e2986d2f4452aa4ed6eec2270a7e6e576b60f2067e6c6066b4e0f17695a4f86748bad5359376f756cb224f1da3efb8013734822452cab8e4f181919c500753457123e29f86a5f12586916f7466177079a2e5637d8a495d83eef39dc727a2edc1e7a3fc37e26b483c3f7fa96a7e2cb7d56de3bd9235ba5b610aaf4c44807fac3e84649ce066803b3a2b99ff8585e155d1e4d55f58863b48e63039911d5c483aa14237eeef8c671cf4ab9a0f8b742f13b5d2e8da8c5766d582cc1011b739c1e40c8383823838a00daa2b97f19f8bac3c39a65c44da9456da93dbbcb6ead0b4d8c7019957eeae78dcc40cd61783fc477fac5c7869aefc4d019ee74bf3ae74b16cbe64afd7cd2c07c8391c7038ef9e003d168ae723f1ef8564b95806b9688598aa3c8db2390838211db0afcf1f29353c5e31f0f4fae9d122d5addb50cb0110270ccbf79437dd2c3ba8391dc5006e515ca49f127c211c37928d72ddd2d23324bb0337ca182e5703e619600119049acdd3bc6d07896efc2b73a66bd636a97624379a61c492cade5eed80e011b08393c03fa100ef68ac33e31f0f0d6c68c757b6fb79631f93bbf8ffbb9e9bbfd9ce6a13e3df098b95b7ff84874f32b4df67555981cbe01c71f51cf4cf1d6803a2a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a2b8fd43c45e33b6d42e21b2f020bcb6490ac571fdaf147e62e786da46467d2aa7fc255e3dc7fc938cffdc6e0ff000a00eee8ae0ffe12bf1f1071f0e3dbfe4350f5fca97fe12af1e9603fe15b9c7aff006dc1fe1401ddd15c27fc257e3dc81ff0ad9b1ebfdb707f853478b7c7783ff16da4cf6ff89cc1fe1401ded7857ed11e127b9b4b2f14daa167b7c5add0009f909ca37b61891ff0215dc8f1678efbfc36907d35ab73fd291bc53e36915965f86b2327500eaf6e738e68026f855e0d1e0df055b5bcd185d42e809eecf70e470bd4fdd181c71904f7aedab881e2cf18907fe2dddd65783ff134b7fd39e6957c57e313f7be1ddd0e33c6a96e7fad007177de041e30f18f8cdef6c2eed4de2db36977f2db32ec9238f0c41238190011c6474e9c2eaf1f8ab5bf0b68cba9e837f26a1a15deebfb487745f6a88232f990c919196c1fbaa739278c75ed1fc59e2d5fbbf0f6f49eff00f131b7ff00e2a9dff09678ac139f87d7f8ed8d42db9ffc7a8038193c39617645fc7e12f1068d0dcbf9b1ea71cd34d7f04918c0764cb9dadbcae072704f4c1166dedfc4d657de05d6355d1afaeded1f50f3c5a5aa8933367cb674076a16ce4e4e0127241aed3fe12df14e703e1f6a38c67fe3fadfff008aa78f16f89b1f37803521f4bdb63ffb3d00727a25acc9f0f3c771cba45fa5e5ddd5f49044fa7ca24904ca563da36e4e7be3ee8eb81cd50d29756f0c5ff867c413787753beb0ff00847a3d26e21b7b563716f2ab163ba360091918cf4ef9e99ee8f8bfc4633ff1416a84678c5ddb9e3fefbad6d0b5bd4f54b89a3bef0e5ee9688bb9249e589839cf4f9189cf7fce80380b5b7bdd23e21e8babcbe159ed2c1f4996d62b7b0b6dcb6ec672ca1c270adb082dd89dd8c9ac5b6d3f57fb3596a71691a8bc161e279afeeece6b2911da1958849954805ca8e70b9233c8af76a2803c17c5da35f6a97de25d66db4bd44e9faa4f631431fd8662d379454c92347b432a800819033ce3dfb6f0e9f33e2c6b77ab617f0dbdc58c11453cd633449232e4b7ccca00c7039ebdabd128a00f26d5e4bed1bc65e36fb5e85a9dfc3ad58c496125b5ab4e8db6228636c676fccc4e0f1c127a8ce6786a1b88757f0c7db34ad5a24b6f0dbda4c5ace545594e0eddc400a480792401c6715ed955afec6db53d3ee2c6f23f36dae6368a54c91b958608c8e4707b500780f846fe05d3bc2f26baf796569a32c8f6f336992ed6f38109ba6e81402390003c67a66adf8674bb68f4ab1d1f56f087882e358d2a6f30a3dc4eb66bb58932a10c57247202a9dcdc01839af4cd3fe1ce9762cb1bea1ac5dd8a3298ac2eaf99ede3da4151b78dc06070c48e2bb0a00f08d3b4ad44596ad61a5aea7a8e98741bb8a08b50b2923b8d3d9d17102b30024dc401819c6d18c7f15cd3e79ee2ff00e17ac7a7ea318d3ade486e5e4b295563630220c9dbd37ee5c9f427a609f6ba2803c160d3750b9f86ede06b9d3aed7c4f1ea05d65960728499b79b81363681b4b0ce727a639e60bcd3a793e1d7c40b78f4bb96bdbcd74c90016727992c665465206dcedc2b9f6e7d79fa068a0086d241359c128ce1e35619041e47bd4d476a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a2b867f86bbdcb1f1a78c077c0d53a7fe3b4cff0085623181e35f18018e47f69f5ffc76803bca2b826f85fbbfe676f1863fec27ff00d8d1ff000aca4ce7fe138f187fe0c87ff13401ded15c28f86f28e9e38f177e3a829ffd9297fe15c4d9cffc26fe2dff00c0e5ff00e22803b9a2b87ff8575718c0f1c78b3b7fcbea7ff11483e1d5d641ff0084ebc579ff00afc4ebff007c5007734570e7e1f5ee78f1cf8a31ef7287ff0064a5ff008402fc2e17c75e26e7a933c67f2f92803b7a2b857f87da9b7ddf1ef8901c6399233ffb28a3fe15fea61815f1e78938eb992339ff00c77da803baa2b873e02d63042f8f7c403d32623ffb2d21f02ebdff0045035be9ff003ce2ebff007cd00773457103c11afa312be3ed67d06e8e2381ff007cf35bde1fd2351d26199350d72e75569181579d113cb03b0da07eb401b345145001451450014519a2800a28a2800a28a4eb400b4527078a33400b451450014514500145145001451450014514500145145000338e7ad145140051451400514514005145140051451400557bebfb4d32d1eeefae23b7b742a1a595b6aae485193f5207e3562b8af8b0a5be1cea0150b319adb001c64f9f1d0076b4520e052d0014556bdd42d34d8526bc9d218de548559cf57760aa3f124559a0028acbb6f1169377aedce896f78926a36b1892685413b149c72718cfb6735a940051451400514550d5f5ad3740d3deff0055bd86d2d538324ad804e09c01d49e0f03934017e92b3935ed31f5a8f475bb5fed092dbed690ed3968b38dd9c63af6ce6b4a800a28aced5f5cd3741b68ae354bc8ad619665811a43c176e83f99f6009ed401a14b49eb4b4005145140051451400514514005145140051451400514514005148cca832cc1467192714b4005145140051451400514514005145140051451400514514005145140057ce7e3bf8d4fa8e9d7de1db9f0d4b677715ca2cbbaf036c78a5562bc28cfdc2320f7afa32be6bfda17c22d61afdb789ada33e46a004370476994707fe04a3ff1c3eb401e95f0f3e2bbf8ff00559aca0d065b58ade2f325b93701d549e1571b47279fc8d7a55709f09fc1a7c1be0a821b842ba85d9fb45d03d5588e13fe02303eb9f5aeeb1c7a5007907c52793c517977a25bc3a93c7a55b9991eced259737cc0346a4aa9da153be7fe5a8feed6845f11ee6f3e1c6817f66f1aeafaa5e43a53c92202b6f39387764c8fee92173fc4b5db787fc39178752f161bebcbafb5dc35cc86e4a13e637de20aaaf5e3ae7a718ae6ff00e15368e6cf50b59352d5648ef6e8df1cc91af95739cf9d1ed41b5ba8f4c1e9401c85edeebbe19f1878b2e1b58b5b8bf8b4db5105dddc01308d311caa0019802400a393b7827831cff113c5569a0f8d025eabcba335abdbdc5ed888e7649b8c140428232a412b9c755c9e3abbbf83da56a2f3cf7dadeb97179288b172d70a1d1a327630c281900e3a7bf5e6b17c77f0f069be16f115de9b71adeabaa6ae9045242ffbef3191d4ee21538c056f4033818c8140143c63af78e7c3eb2595febf0490eada6dc5c5bcb6d68236b678a3ded1a9ce7695e379c9c9c8031cd8b1f10f8ae1d3bc3fe18d2a4964b93a1457ed756d6f0348aadf2c68125755dab8f99b249e3017ad76167e01b3beb2966d5353d4f5092eb4d36313dd058deda175f982a841873c64b027800f7cd697e13e9cf069ef06b7addb6a3631f931ea115c8598c5800467031b401c000772724924039b1e26f895aa7882c74047d2b4ad466d324b9955e2f3046cb2140720b0c9da38ec18e41205753f154cf1fc22d63cf6469fc889642830a58c880e01edd6ade9bf0ef4fd27c436bad5a6a3a889ededcdbec768dd645662ee5c94dc4b392c4e7393c60715afe28f0e5bf8af409f47bab9b9b7b79caf986dca86600e40f994f1903b76a00e45fc43a969fe3d5b116b6f75143e1b7be8a38a1c4cec180f2f7f2704a9c0031c8e091591a1f8dfc4fa86ade1916faa6997d0eb70c93ddc22d4e2c04601600abe46490b97ce08fc2ba4d67c152c335d7882c6ff0052bbd5e2d264b08600f146255c1206e54054ee20e41183edc579e681e1dd63ec96da6e94fe27856511c1796f7da6476f0f9470b2ee93827e5dd8da4b74e7bd006c681f103c4fa9788346b17bfb293fb5d2ea362962de4dacb12311e5c9bb130ce376091e879aced135ed7e1f863a66b1753e9fa89bcd69408ae6d3738669df73025f19dd8230a36e3f11d969ff000a21b1bdd12ebfe124d6253a3b30b54768f6ac47398f85ee0e09ea471c718583e13dac1a37f64aebda98b18eed6e6da2023c43b5d9c28ca9cfccc492793803a0a00a9a8f8c7c45a8b78a6ff409ecadec3c38ce863b8b73235dc91a969413b86c51d06324e339e6b357c79e2ed75353b8d2df4cb2b4b6d1e2d506f81a5914b23318cf201c9523763818f9726baad43e1d4377a96a37369abdd5843abc221d5618238c8ba014aee0581d8c41209039cf4079a78f871a7c573a9496b7d776f0df582e9e60458f6450aaed0172b9e84f527afd280373c2daacbae78574ad5274549aeed6396455042862a09c67b67a56bd66e83a3a683a159e9514f2cf15a46228de50036d1c0076803a5695001de8a28a0028a28a0028a28a0028a28a0028a28a00e5bc79e09b7f1d684ba74d7b3da347279b1491fcc03e08f997f88727b8fad797a78afc7bf0a2e16d3c4d6afade87b82477aae5980f673ce7afcafe9c1c57bcd3258a39e268a58d648dc1565719047a114018be18f18e85e30b2373a35f24fb71e6447e59233fed29e47d7a1ec6b76bc97c4bf052d5af86b1e0cbd6d0f548c9758d19bca76f639ca75c71918e31599a47c5bd7bc25a8a689f11b4c92293aadfc6a3e65ec4aafcac3af2be98c673401edb4552d2f57d3b5bb18efb4cbc86eed9c656489b70fa1f43ec79abb4005145140051451400514514005145140051451400553d474bb1d5e08e0bfb68ee228e549955c747460ca47d08fc7907826ae514005145140051451400514514005145274340076a2968f7a000fbd211d3da8eb4b40051494b4005145140051585e20f19681e169ad22d67518ed64ba6db12b0249e719380768e7a9c0add072322800a28a2800a28a2800a28a2800a2a3f9f7f5f96a4a0028a29ac48048fc73400ea29aac4a027b8a5ef9a003154757d1b4dd7b4f92c354b38aead641868e41fa83d41f71c8abd9e71466803c4b55f84de20f07dfc9acfc39d5664627e7d3e461f30cf405be57033d1b91ea4d6a785fe3758dc5d1d27c5f68da1eab1908ed229113371d73cc7f8f18fe2af586700e3a9f4ae6fc5be0cf0ff008bac843add92c932a911cf19db2c7eeade9df0723d8d007491c89346b246eaf1b80caca72083dc1a75784b7c16f18e9605ae81e399e1d3c7291b4b2c3b7249236a923f1e3273c5447e16fc512c42f8ee52412326fee05007bdd15e08df0abe29edf97c74f9cffd046e3fc293fe1567c56c83ff0009d3eec75fed2b9e3f4a00f7ca2bcdb46f0a7c45b0d2eda09fc79199101dc1f4f5b83d49c798ec19bf1fa568ff00c23be3fc8c78f2df1ff6068f9ffc7a803b8a2b88ff00847bc7c0ff00c8f76bcf63a2a7ff001748da178f7042f8e2d01ffb0327ff0017401dc515c3ff0060fc40e31e37b3e9df464ffe2e93fb1fc7aac17fe132b23919ff009038ff00e39401dcd15c52e93e3ee33e2bd3c820f5d207ff001da1b47f1f8008f17e9e7a0c1d2401ff00a32803b5a4ae30e91e3fe7fe2acd2f1efa511f8ffacff38a53a578fc118f14e9278ffa051fcffd650076745719fd99e3ee83c4fa413d79d2d87fed4a77f677c4019c788b453cf7d31fff008ed007634571bf63f883ff0041bd0bf0d3a4ff00e3b4efb17c40edade827dffb3a4ffe3b401d7e32296b8b7b7f8831e3fe26fa0119c67ec12fff001cae5bc47a2fc5fb9bf5974df10e98908882b0823f286727270c1fb1eb9fc38a00f5ca2bc29741f8e4c78f105af1dcbc67dffe79d0743f8ea99035cb57f9bfbd173efcc7d2803dd7b75a08c8af0a6d23e3c6571acdb9e3b3403f0fb94d3a4fc79190356808cf6783f3fbb401ef1457809b3f8f6a769d413d7ef5b7ff00134b2597c7c40bfe9c87e8d6bfe1401efb5e77f123e2ad8f8262fb059aa5eebb2a8f2edb2711020e19f1f87cb904fb75ae192cbe3d38c7dbe3e7afcd6bc7fe3b5d57c3af8470f86aee4d73c433a6a7aec9233aca49748b27ef02dcb39ea58f4ce07a900c6f01fc2cbfd67523e2ef1f97bbbe9d84b159cd8e3a106403803d23e80704761ed9452741d680168a4073d88a5a0028a28a0028a28a0028a28a00290671c800e7b1a5a2800a28a2800a3145140098a3a53669a2b68249e791238a352ceee70140e4927b0af09f177c41d6be226acfe0ff0001c6ff006590325d5f7dd1226307923e44ebcf56e00f4201e87aafc5bf04e8da84b6377ada79f11c388a192500f71955233f8d513f1bfe1f8c9fed8727d3ec72f3ff008ed43e1cf825e11d27488adf52b04d4ef48ccb733161b9bd0007007f935aedf09bc08c727c3769f9b7f8d0050ff85dde000b9feda619e9fe8937ff001147fc2edf87c7aeb87ff00e7e3ff1cabfff000a9fc0a460f86ed3bf77ff001a8cfc21f01375f0e5bf4c71249ffc550054ff0085dbf0f41006ba7ebf649f1ffa0529f8dbf0fbb6ba7ff0127ffe22a7ff008539e00ffa17a2ff00bff2ff00f1741f837e00273ff08f47ff0081137ff17401b30f8ebc257112489e25d276ba8601af2353cf3c82720fb1a78f197858138f126919ef9bd8ff00f8aa8e3f01f84628d235f0ce9384000dd668c78f52464fd4d487c11e146ebe19d1ff00f0062ffe26801fff000987860b63fe122d2723fe9f63ff001a3fe12df0d939ff0084834a3e9fe991ff008d447c0de136ebe18d1baffcf8c7fe14d3e02f081393e18d23ff0000e3ff000a00b47c55e1de3fe27ba673d3fd2e3e7f5a41e29f0f6d18d7b4cc7fd7da7f8d561e02f080181e18d1f1ff005e51ff008507c07e10e01f0c68ff00f8051ff85005b1e27f0f9202eb5a6927a7fa52723f3a3fe125d00b0ff89d69f9edfe929ce79f5aa87c07e112307c31a3ff00e0147fe14d3f0ffc1c460f86348ffc034ff0a00bff00f09068a402356b139ffa794ff1a95756d33a8d4ad0e7fe9baff8d64ffc2bdf07753e19d2bff0113fc28ff857be0e23fe458d2707d2d53fc28036bfb574fe3fd3adb3d7fd6aff008d1fda761d3edd6f9f4f357e9589ff000aefc1dff42d697d31ff001ecbfe14bff0af7c1f8ff91674affc054ff0a00d97bfd39b00dedb6738c79a3afe74e37d664645e4183c67cd1fe3584df0e7c1ac727c33a60fa5ba8a4ff8573e0d3ff32d699ebfea168037d6f2cd41c5c42001fdf15cfea3f11fc1fa4ea1258deebd6b0dcc78dd1924e32011c818e8450df0d7c16c727c37a78fa458fe559975f063c057772d3be84a8cd8cac53c91afe0aac00a00b7ff000b5bc0bbb03c4b659c7a9c7f2a6afc56f03b9da3c49643dd89038fc2b31fe07f800918d1a4503ae2ee6ffe2e99ff000a3bc044ff00c8224fc2ee5ffe2a8035d7e29782587cbe24b104f4dcd8fe94a9f143c14c00ff0084934f18ee64c5641f819e023cff00654a3e9792ff00f154d3f02fc0640034c9bea2ee4ffe2a8036bfe164f8215cb1f1269bcf3c4c0f35d3d9df5adf4097169730dc42e32b244e195be84579e1f813e052ac3ec17009eff6a938fd6b9eb9f80971a5dc35df843c537ba7cdb784989049f42e98207fc04d007b68e9d28ed5e1675af8d3e110ff006cd362d76d55828912259491ec23daff008b2d6a68bfb41e83712fd9f5dd3af3499c121db06645c7ae00607db6d007b0518ac5d0fc5da0788d03693ab5add12371447f9c0f743c8fc456d751c734007e34b49de96800a28a2800a28a2800a28a2800a28a2800a28a2803cbbe27f84bc63e32d5b4fd274fbd86dfc3922eeba7070cae0e7e75ce5c74da0719ce71c1aecbc25e0fd27c19a42e9fa543b73832ccc72f2b631b98ff004e82b7e8a0028a28a004e6968a2800a28a687466655605978600f4fad003a93eb4b4500149e94b4500158de22f1043e1db7b39a681e5fb55e4568361036991b009cf615b35c3fc4cdbfd9fa02b7f16bb663dfef9a00edc9a323f0a4e83b1c50c5829da32d8e01e0668014d1deb94f0978bee3c517baac274a169169b74f672486e43ee954e080028e3deb4ae353d521f135ae9f1e8cd2e992c2cf2ea3f685022719f94c7d4e70391fdef63401b3464e69824071d39f7a50c33b430c8ed400ea5a6ee19c679a0367be6801683d3ae2827029323b9a000807bf4a071eb4175c75ce6985c6de304fa03400f19ebd28e4f735c1da7c41bcd4b45d4efac7c33773dc58ea874e6b313a6f246ddcc4fdd18dc4601238ce71922f788fc6afa4ea2ba5697a54daa6abf636be6b549047b6156c673839627202804f07a71900eb4055270002793ef4a39e78acaf0eeab75ace856d7f7ba6cda6cf32966b595b7327240cf4ea067a64679ad40d9ee28014fe43deb2f58f0de8bafc41356d2ad2f40042b4d10665cf5c1ea3a76ab773a85ad9dc5a4134c125bb94c50a9c9dee119f1c74f9518f3e9ef55748d52e7519f518ee34bb9b216972d0c4f31e2e1074917d8ff009ee00079ceb7f007c3378a64d1e5b8d2e700051e619a3ebc921be6ce33d1876ac83e18f8c1e102b1e87adc7ad58a105639994b6001c112f2a3d95fb57b8e78e68fe7401e6be05f1ff89f5bd75744f10f8564d3e7585e492e8ef8d1b6903e5565e7a8e8c7d6bd2a8cd19e7140063de8a514500145145001451450014560f89bc65a178412d9f5bbdfb32dcb948f08ce4e07270a09c0c8e7dc56bd9dedaea3691ddd95c45716f28dc92c4c19587b114013d145140051451400507819a28a0028a28a0028a46608a59880a06493d85247224b1ac91b0647019587420f43400ea28a2800a4a5a4a0064caed03ac6e51ca90ae31953ebc83fad7c8fe32f1cf8f20d664d175dd5449369978b2a62da3502443947042838208233d8f4afaf2bc4fe357c35bdf12eb1a4eaba34064b89a45b3bbc0ced527e490e0741f3027d36d005ef82daff008c7c56b7dab6bfa899f4e4fdcc09f678d37c9d59b2aa0e00c0f4e7dabd73000c566787742b4f0df87acb47b35fdc5ac4101c6371eec7dc9c93f5ad1744951924456460559586411dc1a00f34f8677f656971e356b9bc86251e21bb7264900017e5f9be9ef54eeb52d3b5bf891a1df5b4f7096d79a75eab6f99d09452143ae0fc81829208c12307ad7a01f0878698e5bc3fa5e7febd23ff000a74be17d02691649744d3ddd6311296b542426301471d31c63d2803c0f43d3e1b0f07f813c476a654d5e7d685ab4ff68724c6649414da4ed00f7c01d49ee6ad787a786f7fb33c4175e28b6b6d760bb26f2de2b3737d365b0f1b8f33e6400764c281c630457b81f08f86da248db40d2cc68c5957ec71e0138c90318c9c0fc85594d0b498f537d4d34db45bf9061ae960512b76e5b19e82803c03c3571650f8b7c29730df450c3aa45791ddcbf6c2d7532b02419dd48c316236e39047de38e3b7f837e1db37d16dfc4b35c5dcba8b1b8b72d25c332ecf389c609c7505bdcb1279aefc7843c36b1ac6340d2bcb0ccc17ec698058618818e32060fad5dd3b49d3b47b76874eb0b6b2899b7b25bc4b182dd32428eb803f2a00f13f89777697fe26f12289945c695a7c6e925e5c9416f2637afd991704bb1d9f312307b1c81525b5958f8c3c77650ea7753dedb5c785a39e7097920579848aadf75801f328ca8e370ce335ec17be1dd1b50bb37b79a558dc5c18cc4659a056628410577119c60918f7355e3f077866393cc4d034c0e63f2f77d9133b36eddb9c74dbc63d2803c474cb7697c2fe09f103dedebeaba86a074eb99fed9265edcb48bb3ef617851c8c1cf3d79a8f40d392d7e1ff00867c55677b72be24935316f133dcbb8995a770622a5b0011963c0cf3cf39af6cb9f04f86cd998e1f0de90cc9b9e147b54550e47a8538ce064e0d62fc3cf87b6de16d12de2d4b4dd2e5d5a06907dba18f7bbab127ef3282386db8e781d79c000f3abade7e1f78d658e5962962f1648c8639990732c4a7760804609ebc743d85741a8f8734dbef8e6f1ca2e3e6d0bed8cf15d4b1b2cbe76ddc0ab02063b0e3db3cd7a18f04785842f0ff00c23ba5794ec1d93ec71ed2c33838c75e4fe7487c13e15925f35bc39a5348576ef368878c631d3d2803c5fc3daac32f86bc05a67882fe68b44bdfb735c96b831acd22c8762c8e0838e4f19009233d2aedff00f64dccfa5f85ec75d9b5bb6b38aeddfedb7ad0db2c4482aed2a9fde797ca80b9e41e500c57af9f06f86db4c3a63685a77d80c9e6fd9c5ba84df8c6ec63ae38cd3ee3c27e1fbb8ad22b8d134e923b318b646b642211e8a31c741f9500784e8ef6fafcdf0d6f759be96595e3bf86eee3ed6e8ca91025373061b4804127209046735a326b37da7693aec51ea1762c1fc5cb657372d70ecf15a60671213b9461557767a1af625f07786a3b682d9741d3961825f3a28c5b200b2776031d781cfb0a920f0ae836b6f7505be8d631437631711a40a1661cf0c31cf53d7d6803c4fc78975e1cb8f10e91a35edf47a30d320bcf2d6ea465b799a711ed0d9c85652c4a9241ce7b0c76da023e8ff17bfb2ad6f2f25b3bad096f275b9b8694b4c25dbbf2c78e38c2e07b715d7a7827c351e9ef611e85a7ada3b091e1fb3a95661c02463938ab30785f42b5bf8afe0d22ce3bc8902473a4203aa85da141ea0638c7a5006b76a3d28a28010a29e4a83f5a2948cf7345002d14514005145140195aff0087f47f12e9ff00d9facd9c575031caabf0ca7d548e41f715e437bf0efc63f0e6ee4d57c05a8c97d66cdba6d3e55058a8e7054f0fd3195dadcf15ea5e2bf06e93e2fb68135059a3b8b625ad6eade529240c71965238fe11d41e95c8aeb5e32f87c4c7e2381fc43a0a631aada2813c0b83feb23ea40c7defc49278a007783fe34689aec82c35a5fec5d543f96629c9f2d9bd0391f29e3a3639c019af4d072323a5701aaf867c11f1674c1a84324771205d897d6876cb19e0ed6047fe3ae38cf18cd7039f887f071b27fe27fe16878ebfead7f568b18f7419f53401efb45723e0ff00891e1cf1a204d3aecc77a172f6770364a3e9d9bfe024fbe2baea0028a28a0028a28a0043c8c11c50000300607a52d1400527bd2d14009ce7da8a28a005a43dbd68fad14005212734bce68e9400828ea3fc28e9474a0031e868e714679ebd697e98a004e71d314a7a518fad203400b8149dba7e14b49cfd6800c7bd19cd1d3ad19ee0d002fd78a39a4c8ef4bc7ad00277e94b467eb49f87e7400bc7d73457996b7f17ad6dfc6fa6f86742b36d5667b9115ebc47fd58e4154ec587de24f00291ea57d317919c6280003bd28e94500e47422800e9c52d275ed450018f7228a28a005a28a2800a28a2800a2b9af17f89351f0cc16f796be1fb8d56cb2c6f1ede501e0518c1098cbf53d318c726adf877c57a278aec8dd68f7f1dcaae3cc41f2bc79ecca791d0fd71c50073fad7c35b49f503ac786ef65f0f6b44ee69ed46629b9c91247d1b3ffd739acfb4f889a9f872f23d2be20e9a2c6463b21d5adb2f697072473c7c8780707ea428af4aa86eed2defad64b5bb8239ede552b2452a865607b107ad00799f8a3e0ff87bc4ea9ac7876e174bbf7c4f15d599cc521e086c0381ea1948eb9e6b9ab3f88de33f8717d1693e3dd3defac4b6d8b518ce58a8e33b870fd338386e726ba8b9f879ac7846692ffe1e6a46da327cc9747bc6325bcc47652c72a4fd7d390055bd3fc7ba2f882797c33e2cd2d749d5243b1f4ed40078e6f428f8dad9eddf3d33d68036ecbe23783efed63b987c47a688e4e825b858987d55c823f1156478ebc2447fc8cda47fe06c7fe35c55e7c00f05dcdc34b08bfb653d2286e32a3fefa04feb500fd9e3c218f9ae755faf9e9ffc4500779ff09c784fb7897483ff006fb1ff008d3878dbc2a7fe664d23ff000363ff001ae09bf67bf07edc1b9d578ee264fe5b293fe19e7c21c7fa5eaff513c7ff00c45007abc1710dd5bc7716f2a4b0c8a1924460caca7a10475152120753f9d7096df087c1f6b671db25a5db6c408646be9b73606324060067d801cd387c25f0801836374c3d45fcf93ff8fd0077391eb46e038ce2b8aff8553e1209816978171d3fb46e31ff00a1d27fc2a9f096466ceecfa1fed1b8ff00e2e803b52ca3b8fce82c07535c58f857e145394b6be5fa6a371ffc5d347c2bf0b86cac57e3dffb46e3ff008ba00edb2290b8eb9c0ae34fc31f0ef63a98e3191a9dc7ff00174d1f0cbc3c092afaafd06a971f97dfa00ed778f5fc6827d2b88ff8565a1600f3f565c64606a93fff0017591e20f0d784bc3496c6fa7f104af77218e18edaf6ea5776c13c05627a027f0a00f4dc81d4d26e1c723afad78e28f0af980ad978f063203017dc77f5a91ffe11424a28f1d027ae7fb439a00f5e120c8f981fc69d9ce3a8af1cc7854e434be3c0bee2fb07f4abda2699e18d7756934bb5d5bc590de47079e63b9baba8494ceddc37e3bf1f9d007ab64679a8dae208df63ca8add70580ae44fc39d3c0ff90d78807a7fc4da6ff1ae5359f809a36aba9497b26b7ab6f90004cb30958e063ef3024f4f5a00f563796c080268c9f634bf6b80b6d13213e9bc578c1fd9cb43233fdb7a829f711ff8521fd9bf48e02eb97fee4a27f85007b47da610a0b4a801f7a45ba85ffe5aa1c7a1c62bc587ece3a6718d7af40f43026683fb376964f1afde63de14a00f6cf3e2191bd78f7a3ed10f1fbd404f4e457881fd9b6c31f2f88ae81f7b753fd69e7f66ed346dff008a8aeb19e7f70bcfeb401ed725d431233c9322a28c92cc001f5af0bf1a7c42d57c7dacff00c21be030cf14995babe5c80e9fc5838f92319e5bab7007fb532fecdd60245dde22b965cf205b2ff3dd5ea5e11f04689e0ad34da6936db59f066b8930d2cc47f79b1fa0c01e940195f0f7e1ae97e04b1263db75a9cabb67bc65c12339daa32768fe78e7b63b7a5a4ef400639a39cd19a28003ce39a39a3a64d1400b4521228a005a28a2800a28a2800ae2fc47f0e34dd5f501ac6973cba2ebc87725fd9f1b8ffd344e8e0f7ee7b9c715da51401e69078e75ef07491d9f8fec3fd10b6c8f5cb25dd0bf031e620e509fa727a0c0cd7a1d8dfda6a7671de58dcc5716d28ca4b1306561ec45492c515c44f14f12491b82ac8e010c0f5047715e777df0def342bb9355f00ea474ab863be5d3a5cbda5c1ce7183f73b8c8e9d06da00f47cd647887c31a3f8a2c0d9eaf6515cc59ca9618643eaac3907e95cb68ff0013e14d45747f17e9efe1ed54e046276dd04fee920e3afa9c741926bd00104641073ef401e7f69e03f13e916e965a3f8faf6dec22c8862b9b18ae1917b2ef61938e7f4a95fc29e3a63c7c467cff00d81e015ddd1401c23784fc72cc09f888fd7fe8110503c27e3bda73f115b3ff0060683fc6bbca4a00e0c7857c78071f118e3d0e8b01feb49ff08af8fc8c7fc2c720ff00d8161ff1aef71ef410280382ff008457c7ddbe232e7fec0b0ff8d21f0af8ff0077fc946183e9a2c3fe35df51401c09f0a78f7a8f88d923fea0b0ff008d27fc22de3febff000b1573e9fd8b0ff8d77f8a3de80381ff00845fe201383f10632a460ffc49a2e7ff001ea43e19f1f600ff0084fe2ce3a7f62c5ffc5577dec3f95211fe71401c11f0dfc410368f1fc3ff008268bff8aacad4fc19f10a6d574ad493c4fa6ea73584cd24715dd97d9d01642a4e6324b704fa57a91008a4e0e0f18ed401c17fc5d7c7ddf07fe3f68a3fe2eb2e088fc21f9dc7f8577b91ed4bf53c500703bfe2a74f23c24467b3dc7f854be1cf0f78a078de7f11788db4a4274f1651c7a7b487a49bf2778f73d0d773d7bfd6818ed9a00f33f8af7977a7dc68b7575657d79e198da4fed28eca528d9c0d8cdb4825472719032067b5737e229f4f7f843e21d53c3bae5d5d598bb864b361752992d7989190963b8756c03d981f435ea1af5bf885755b1bed145a4f6f1452c7756973334625dc54a95215806054f2474623bd701aa7c31d62f742f13a5a45a65adf7886785e4b7499c436cb1b06c8611fcecc724f0073c74e4020d175244f88fa35af83b54bebfd35add8eae86e24b9823f94ed6dd213b589f43d87be7d7acef6db5087cfb39e39a2dc57cc89c32e41c119071c104547a6a4eba5411de4104770a9b648e290c8808f462a33f90ac0f87807fc23d7202145fed1bb2819483b4ceeca7040ea08fc2803adc77cf3eb498fca968a000514b49400b4527d296800a28c8a2800efd28a28a0028efd28a2800a28a2800a28a2800a28a2800a28a2800a4a5a28033b58d134dd7f4e92c354b38aeada4ea920ce0fa83d41f71cd79e8f0b78bbe1fbf9be11b83ace8dbb7368d76c04918efe5487f1e3f462735ea7487ad0079ddafc68f0918766a93dd6977aa4acd6b736929789875076a91fe7a0ab3ff0b97c043fe63bff009293ff00f115dd6d1e828dab9ce06680387ff85c5e030a09d77191ff003e93ff00f114d3f197c05839d7b18ffa759bff0088aee8c6a48e071ed49e5a74dabf950070a3e32f80b381ae7d7fd166ff00e229dff0b93c047fe63ebff80d37ff00115dbf951ffcf35fca8f2907f02fe5401c40f8c3e03c91fdbe83eb6f2f3ff8ed387c61f019ff0098fa0fadbcbffc4d76a22418f9107d050618f3f713f2a00e28fc60f0175ff84823ff00c0797ff88a41f18bc04c71ff0009047d3bc128ff00d96bb5fb343ff3c93fef9149f6683a98a327b9da28038cff0085bbe046e46bf174cffaa97ff89a70f8b3e07233ff00090db9ff00803fff00135d8fd9a01d218c7d1451f6583fe7927fdf228038ff00f85b3e07db9ff8486dff00ef87ff00e26b9cf147c44d3756d5f41d37c3de2f8ace3b89e41797316cfdda08c9524c8b81f30c57a91b5809cf949c7b553d47c3fa36ad1c69a8e956576919ca2dc40ae14fb6471401e74639482f1fc605c9ce094b56029cb6f7ae70bf17e327feb95a9e4ff915d8b780bc23ff0042be907dbec71ff8520f87fe10ce7fe118d23f1b38ff00c280391365aab49f2fc5d8c2f236b5bdb75eb577c217dacc7e3ebdd22efc4e75cb44d396e15fca89023b48571f20f45f5efd2ba23f0ffc207fe659d247d2cd3fc2af697e1ad13439de6d2f4ab2b29245daef040b19619ce0903a67b5006afe340e9c8a0d1400b474c0a3bf4a2800a3346696800a3eb499f7a2800a28ce4d2d00266814b45001494b45001494b4500145145001451450014514500145145001451450014514500145145001451450014514500252d145001499e2968a004a3f0a5a2800a4a0f4a5a004fc68c9cf4e3d68eb41c77a002819149ed4b40051cd18f5ef4b4005274a28ed4005191d28cfbd273ef400b41a3f951400503bd1d0d1400b49452d0014514500145145001452601ed45002d145140051451400514514005145140051457967c46f8b5168121d0bc388350f104cde5058d7cc1012718207de7cf017f3f4201ea79149915f3fd97c0cf12ebd0aea9af78a66b6d4ae3e69637469d97a6016de39c761c0c601ab07f676bd27fe4749318ff9f46ffe39401ef39a2bc23fe19e2f76851e339428e462d0ff00f1da51fb3dea4071e36978e9fe8adffc72803dd723d696bc24fecfdaaa9053c6d36474cdbb8ffda94e4f807aceef9fc733819cf1039ffda9401ee9457203c1bab0181e38d77a63a41ffc6e9dff000886ae3a78e35cc63ba407ff0069d0075b45723ff0896b83eef8eb58c01de0b73ffb4e81e13d74163ff09d6afcff00d3bdbfff001ba00eba8ae40f84f5fc9c78ef56f6cdb5bfff001ba61f0878898107c79aae7b7fa35bf1ff008e500763ef8a3bf15c80f09f88c36478f353c7a1b4b73cff00df14c6f09f89cf29e3dd441edbacadce3ff1da00ec8fe347e15c49f09f8c037cbf10aef18e874d8339f5e94d3e13f1915c7fc2c3bbcf63fd9707f85007714570c3c27e3407fe4a25c9f5ff00895c147fc229e36e83e22cdd78ce9501a00ee68efd6b833e14f1c91c7c4593af43a440683e13f1ded207c456271804e8f0500779dc5274e715c13784fc78463fe1629c1ebff127873fceb8ad43e16fc4d9efee668bc7aecb248cc08bb9e2c8273f717e55fa0e0741401ee3dcff008d031d457827fc2a8f8a58c2f8edfdbfe265723fa534fc28f8ab9f97c70e73dffb4ee7fc2803df8118ce78ed8a507b57cfff00f0aa7e2c29c8f1b9ff00c1a5cfff00134eff008555f15f247fc27247fdc52e79ff00c76803dfbbd1cd781c5f0c3e2e43223a78dc1653901b53b923f22b823eb5623f157c5ff07388f5bd07fb72d558fefa08b7b3281fde8ba0ef965cf5a00f75a2bc9747fda03c2f78cb16a96f7ba649b4ef674f323561d815f98fe2a2bd174bf1268bae296d2b55b2bdc0048827576507d40391f8d006ad1499e334b400514514005145140051451400514514005145140051451401e41f13bc7daf2eb43c13e15d3eec6a972abbae82153b187fcb23e9d72fd060fa646cfc38f85563e0d886a17e52f75c9065e73f32c44e7223c8cf7c12793edd2bd0bc887cff003fca4f3b6ecf3368ddb739c67d33daa4a0028a28a0028a28a0028a28a0028a28a0028a28a002a29aeadedda259e78a2699fcb883b852ed8276ae7a9c02703d0d4b5c9f8cf2753f09aa8563fdb2a70de9e4cb9a00ea9dd2342eecaaa3ab31c0151adddb3e02dc44db8e061c726a8f88d124f0c6aab2aab466d25dc197208d87b5793781b48d26fbc07a2d8dd7832e4c979f236b096f08284b311209158c83180012076cd007b6d2579f6bbe36d7342f1549a149616ecf7b1674591518adc49b8029212c02950727db9ea402dd4fc59e308fc60be17d3b4bd225bc3a60bd33cd71208c1dc149200ce321805e7395391c8a00f43a2bcb748f89dab78ae5b7d2343d36d6df5c5b6927bc17cede540c8fb36055f99893ee3008ebd2a2b7f8a7ad6a77fa269fa6e89682f6f25b9b5b98ee6e197c9b88572ebc29f94654e7927918079a00f57a3debca87c54d45b4d86c974f87fb7c5d5cdadced8e496de23063748150190a9dca00c0e49c918e5b67f13bc477b75a0e9ebe1a8e2bed4249e193ed2f244acf147bb72065c843b90e4e48c30c742403d5e8fc2bc66f7c79e2fd4974ab7b6b7b0b5b88b5efecbbed92b8134c8dbb6a9da4ac440e4f2c791803afb2aee28bbf01b033b4f19a005a0714628a005a28a4a005a4c73452d0062eb3e11f0f78855bfb5746b3ba764d9e6bc43cc03d038f987e06bceb57fd9ff43924fb4f87f53bed26e958347f379a89f4e8c0fbeeaf5fa2803c27fb23e32f824992cb504f10d9233318e47f398af6c87c49f8231e7f5b965f1e9f4d9459f8bbc337da7ddaa8dc624c67d4ec936951f8b7e9cfb5556bdd3ecb52b66b7beb482ea06fbd14f18753f504628031bc35e39f0e78b8c89a2ea71dc4b1aee784ab23a8e39dac0123240c8e2ba2ac3d17c1fe1ff0e5edd5e68fa5c16735d00253164020740173851cf40056e500145145001451450014514500145145003646291b32a17600908b8cb7b0cf15e43a77c69b9d2b5c9b49f1de8926912ef2639a256650bce370e4b0e3ef2e41f415ec1599aef87749f12e9cd63abd8c57501e4071ca1f556eaa7dc5005bb2beb4d46d52eacae61b9b7719496170eac3d88e2ac5786defc36f16fc3dbd7d5bc05a94b77660ef934e98e59fd8a8c2bf7e9861db9ae8fc23f1a348d627feccf1044743d5a325245b9f9222c3a8dcdca9f66c7a64d007a7d140208c8a2800a28a2800a28a2800a28a2800a28a2802a6a778fa7e95777a96d25cb5bc2d28822fbf26d19dabee71c5782ebbf1e348d4b52d12e22d26f9069f786e245765cb0f2dd3039ebf366be85af917e28f8167d0fe24be9fa6da936faac8b2d8a28c0cb9c141c0030d90076056803de7c37e325f8a7e18d6a0d2edae34c1b7ecbf69ba8c48a4b83bb685619217df8dca79e953587833c49a6f84e3f0e5a78a2d21b68e1f245c45a632ce14f5c379d80d8ef8e3af5e69f69a4c7f0d7e16c96d6171630cf676e647babbcac4f313cb36324e49c01c9fba2b95b6f1b789223e26b61757127d93473a8dacfa959244ea5720e1136e55b04aef008ee0f700e87c43f0e2ebc451ea06ef58845c33c474db8168dbf4f446ce10f99f79b032c304f3fec85e7b76b07e34c165078834a93558b40f2269e5b525642262db3cb12e55f6e18fcdd0138c1e1f65ae78de6bdf09dbbebf6cff00f09269ed29636083ec8523572eb83f3160d8e78ddce3185acfb0f1978d753d6b49d0a3d5ac22b996f6ff004f96ec58862e6dd011211b80e7702146002bce41c5006c4fe13b2f02ea9a2ea569e228ad357ba0da7bbdedab4eb7ef2c9bc92a854a9dedd738036827d53c3de11b0ff84b6d5b4bf10413de787ae269b53592d18bcd3dc0c48c5b705030b80003b76f24d62eafaceb37d2e8fa4ebcf14f7fa5f8c2ce1fb5451845990a9656201c06c1c90381915b3aaea3acded97c4dd3a6bb8223a7daabc72416a177235bb3329c92725405dc49c750074a00c0d3b47b293c4f141a578d921f124d7d71a85a48ba5ca2299255cc8a3712ae87665581c707a9c11dd2f80b577f11e89adde78896eee34f92595c4b6c4076910464200f8450aa303079c939cd72be1dd4b52d066f87915ccf6b3da5ee992c85dac944d04496e1f6093392bc8e801e392738ae97c3baff0089758d374bf143ea1a547a4de990dcda4c762dba93b630926325f230db8e327000a00ac3e18ea691b491eb7682ebfb74eb48c6c98a07208284799923d39fe7c771a96b5a7f876c2d65d635048524952d96690637c8dd3381819c127a01cf415e65a278efc4b73e29d1f4db8bc8268f578ae034a2c88b7824442c0c0e4832a8e324e47a31ed97a26b3af5afc32d235592f6caf63bdd64068eeac77bef6b962ccadb80c9393f778ed8c66803dd68af32bcf1778875187c57a9e8b75676f69e1d964896dae2d8b1b96893749b9b770383b76e3deb162f1e78c35d1ae5c585d69d636d65a4c3a9a2b5ab3b80d1993cbc96c127ee96f40085193800f67a2b27c33aa4badf85f4bd52e11239aeed639a454fba0b28271c9e39ef5ad4005147b51400507da8a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a280398f1078eb4cf0beb16965abdbdec16d7206dd47c9cdb2b1cfcacf9c83c7a77cf4ce3a2b6b982f2da3b9b59e39e0914324b1386561ea08e08a4bab4b7beb592d6ee08ae2de41b5e295032b0f420f06bcfaebe1feabe1aba9352f00ea5f6524967d1eed8bda4bd3eef743c75f7c6545007a3d729e2ff877e1df1a418d4ad365c80025ddbe126503b6ec1c8ebc1c8e6a9e83f126c6f351fec6d7ed65d035b181f66bc2024c49c66293a3027a74cf6cd76f401e05243f113e0f3e6dd9b5ff000d2755219bc941d78e4c5c03c8ca73eb5e9be0ef897e1cf1a4416caebecf7d8f9acae485947b8e70c3dc67df15d8119183d2bccbc67f06746f104cda968cc747d614f9892c1f2c6ce390594743c7de5c1c9c9cd007a6d15e0c9e3ff881f0e03e9de27d125d66041882f43b0dc071932052187d406e79a07ed1776a4eff0007381ef7847fed3a00f79a2bc1c7ed19700fcde0e931dffd34ff00f1ba4ff868e981c37841c7d6f8ff00f1aa00f79a2bc87c37f1cceb975342de0ed5dbcb4dc3fb381ba6eb8e576ae07be6ba4ff859c9827fe10df18e3fec147ff8aa00eea8ae17fe166a67fe44cf197fe0a4ff00f15483e27c4c091e0df18ffe0a4fff0015401ddd51bbd22c2fb50b1bfb9b5492eac59dada56eb1965dad8fa8fe43d2b935f89d093cf843c60bd793a4b7f8d07e27db8233e12f170cff00d425b8fd6803a6f1168165e27d06ef47d4449f65b950ae636c30c10c083ea0807f0ae4e4f84ba54b24d2bebbe2179a7b4367348f7a1ccb19ce436e523a3118c607040cf35647c4bb72b9ff00845bc599ce31fd92ff00e341f8976eb8dde15f168ce3fe612ffe34012c3f0f2d6dee744b88b5ad5449a3406decf3e410a846d391e572768033ec3be4d717a9780e4d23e20787134ebdf103c2f737777757c96c927d9e5995541dc22d83715c10c08039f94735d89f8956800ff8a6bc55cffd4224e285f89368c577786fc52818f56d264fe9400d97e18e992da59c0353d4d1edafcea4d30688bcf739c891f74641c74c00063a8352cdf0eede5975e7feded5d4eb8a12f40307cca14aed198b81b495e3f9f34f1f10ec8853fd85e250186727489b8f6e9fe7149ff0b174e070da378894f607489b27f4a0065afc3ab5b5bdd06e7fb6f5697fb0e368ace393c8da11942b2b622058150075cf1d73cd55b1f847a05934b09bcd5ae34b7dfb74a9aec9b58cb679540072327049383cf519ad1ff8583a6efc1d2bc40a3fbc7489f1ff00a0e683f1074c0013a6ebd82339fec8b8fcbeed0065d97c26d36cafb47ba5d775e91b49626d55ee970a9c65301461481838c120e338030abf09f4b8b4f8f4f835ad6a1b386e96ea081668d962756671b434678cb1eb9278c93815abff000b03480a09b4d6c67b1d22e7ff0088acfd6fe2a689a2e953df359eaf288881b0e9d3440e481f79d428ebdcfeb40166efe1d69f3deea93db6a17f631ead184d460b6f2825cf04127284a921882548ce73d79a6ffc2b7d3a39f5692df51bfb74d4ed16ca5862584247128daaa83cbe30b95e73c1f5c11c47fc347e83ff00405d4bdf943ffb3503f690d040e745d4bf38ff00f8afa5007ace87a4c5a0e8969a5433cd3436b188a37982ef2a3a03b401c0e3a7ebcd68578c7fc348787b03fe24daa67bff00abe3ff001ea17f68ef0f1233a3ea607b797ffc55007b4515e343f68df0d9009d2356f7c2c78c7fdf749ff0d1be1acffc82b57c7a6c8bff008ba00f66a2bc687ed1de1a39ce93abe3b6123ffe2eb1b5cf8bbad78f25b7f0f780b4fbdb59ee7227b891409157a1c15242280725ba8e318ee01d47c45f8b49a3cd2787fc30a2fb5c93f77e6458916dd8923000cee9063eee300f5cf4aeb3e1e69fe23d37c256f078a2f3ed37fb8b82ce5e4453c857724ee6193c8e07039c66b27e1cfc2dd3bc0f68b7371b2f35b71fbcba2bc479fe18f3d076cf53df0381e8140051451400514514005145140051451400514514005145140197ae787347f12d91b4d634f82ee2c1dbe62fcc99eeadd54fb822b853a4f8c3e1ee5f43b997c49a12f274ebb7cddc2a0748dff8871d31ec0679af4ea28039cf0cf8df44f152bc7657062be88913585c8f2ee222383b90f3c1ee323f1ae8eb96f14780746f13ba5d48b258ea7110d16a3644453a11d3e61d47d7f0c5730be28f16f8048b7f175936b1a3a0c2eb361192f1ae719993b718e47e6c6803d43148140ec3f2ae6a2f887e0e9a14957c4ba585750c37dcaa9008cf209c83ec79a97fe13cf08633ff00093e8fff0081b1ff008d00741b579e07349b148c6d15803c79e11271ff00093e8fc7adec63fad28f1d78489ff919f46ffc0e8fff008aa00df0a140c0031c52d73e3c75e12efe27d1bff03a3ffe2a81e3bf089e3fe128d1bff03a2ffe2a8037c8a2b03fe13af08f38f1468bf8dfc5ff00c5503c75e123ff00333e8c3eb7f17ff15401d05263f2ac13e38f09ff00d0d1a31fa5fc5ffc551ff09c784cff00cccfa367febfe2ff00e2a8037b14702b07fe139f0963fe467d1bff0003a2ff00e2ab8ff197c6cd0bc2f736b1592c5ac8991999ecee9088f0470719e4f3401e9f495e0e7f695b5c8c786a723be6ec7ff134a9fb4ad99fbfe1bb85e390b72a7ff651401eee31da96bc297f694d3c05cf872e73dc0b85e3e9c57a8f81fc5f178dbc389ac436725aa348f188dd831f94e3391401d2518a28a0029ac8aebb5d432fa119a7514015fec3698c7d961c7fd7314874eb16393676e4f4cf94bfe15668a00aa34cb00bb4595b63d3ca5ff0a63691a6baed6d3ed48ce70615ff000abb4500531a569e0822c6d81031fea97a7e54c3a269258b1d32cf71ea7c85ff000abf4500511a2e940e469b660f4cf90bfe153dbd9dadae7ecf6d0c39393e5a05cfe5f41f954f450014514500145145001451450014514500145145001451477a0028a28a0028a28a002918060410083c106968a00a874bd3c8c1b1b623d0c2bfe14dfec9d349c9d3ed73ebe4aff855da28033ce83a39ce74ab139f5b74ff000a5fec3d2467fe2576433d7fd1d39fd2af52d00667fc23ba1f4fec6d3fff000153fc29ade19d05bae89a69fada47fe15ab474e9401927c2fe1f230743d34fd6d23ff000a68f0af8776e0683a5e08c7fc7a47fe15b1450063ff00c22be1ddc5bfb074b249c93f648fafe541f0a78749c9d074b2724ffc79c7dfaf6ad8a4a00c6ff8443c35c0ff00847b4ac0e9fe871ff85727e2ff00839e1bf165d5bcfb5f4d30214db61147187c9ce5be5e48af45a3f3a00f147fd9bf41c8d9acea43d73e59ff00d969bff0cdfa16e3ff0013cd440edf2a71fa57b6e067347e1401e227f66dd1b70c6bd7f8cf3fbb4e95e9de0bf095af82bc3d1e8f697135c468ecfe64b8c92c73d0715d052d0014514500145145001451450014514500145145001451450014514500145145001451450014514500145149400b451de8a0028a28a00ceb8d774ab4d5a0d2ae350b68afe7432456ef200eea3b81f81fc8fa1ad0ce46735f27fc5af0af8cacfc4577aeeb519b9b695f29756d968a24ce113d531c0e7a9ee4d4de07f8dfaef86cc567ab97d574d0704bb7efe319fe163f7be8df4c8a00faaa8e3bd73be16f1be85e30b1fb4e917cb232806581be5922cf665edf5e871c1ae841f5a005ce47d68a29680128fa52d140051451400514514005252d14007514514940051cf6a38ea28cf34007d69693f03476a005a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a2800a28a28020bc9dad6ca7b84824b878a3675862c6e90819da33dcf415cef85bc79a3f8a4bdbc2d259ea7092b3e9f76bb278c8ebf2f71c8e47af38aea6b96f15f80f49f1505b870f65aac44341a95afc9346c3a723a8f63f862803a59224963649115d1860ab0c822bc87c71f01b4ad67cdbdf0e347a5de9e4c1b7fd1dff01ca1fa71c74ef5a96fe34d73c0f709a6f8fa069acde4d96daf5aa66271d84aa3956ebfe0402d5e916d756f7b6b1dcdacf1cd04aa1a396360cac0f4208ea2803e26d5345f137813595fb5c379a65e213e54f1b150dea51c70460f383df9af5bf047ed00504765e2d8738c2adfc09ffa1a0fe6bff7cd7bb6aba3e9bae58c965a9d9c1776ce30d1caa187e1e87dc735e09e3bf8013daf997fe11769e2e59ac267f9d79ff966ddc7b1e78ea738a00f7cd3b53b2d56ce3bcb0ba86e6ddfeecb0c81d4fd08ab82be26d1bc47e26f00eb0c2ce6b8b2b88d879d693a90adece87dbf1f4c57d01e05f8e3a2788562b3d68c7a5ea4782ce710487d558fdd3ecdea0026803d6734b4d560ca181c83d0d29f6a005a28a280039c71d68a28a0028a292801692968a004a28a3f1a0028fad1da908cfb8a0051d2969a0724d28fe5400b4526696800a28a2800a28a2800a28c0ce7bd140051451400514514005145140051451400514514005145140051451400514514010dd5adbdedb496d750473c1229578a550cac3d083d6bce2f3c17aef82ee9f54f014e65b32774fa0dcc84c4dea6224fca7fce48c0af4da280394f0978f34af1596b65592c757807fa469b76364d111c1e0e323dc7a8c8078aeaeb95f17780b4bf1588ee19a4b0d560e6df51b43b268cf6c91f7867b7d704573b6be34d6bc13749a5f8fa2f32cd9c476baedb464c5271c0947f0b7d07e0402d401d378b3c05e1ff0019db18f56b2533edda975161668fae30de9c9e0e47b57cfde21f80be24d3759860d2ca6a16171308d2e07ca61cf7917b01cf23238ec4e2be83ff008581e0ff00fa19b4affc0b4ff1a51e3ef081191e27d23ff02d3fc68039ff000ff857c6fe1dd16d74bb3d7f486b7b74089e6d948cd8faf99ffd6ad2363f10b071ad6839f7b0931ffa32af7fc27de10c67fe127d23ff000323ff001a77fc279e103cff00c24fa3ff00e06c7fe34019df63f887d3fb67c3e7fdafb04b9ffd1948d69f11401b754f0e31e7ef594c3ff6a5689f1ef8407fcccfa3f4ff009fd8ff00c681e3df081cff00c54fa3e07fd3ec7fe34019a2d7e242f1fda7e1a6f736937ff174ad07c48da7fe263e18cffd7a4fff00c5d69ffc275e12c1ff008a9f46e3fe9fa2ff00e2a8ff0084ebc258ff00919f46ff00c0e8bff8aa00cc36df11fb6a3e19fafd927ffe3940b7f89008cea1e183ff006e93ff00f175a67c75e12ffa1a346f7ff4e8ff00f8aa4ff84e7c247a789f46ff00c0e8bff8aa00ccf23e250ff97ef0b11ef6d3ff00f174d68be260930b77e15299e18dbdc67f2df5abff0009d784baff00c24fa37fe0745ffc551ff09cf848e3fe2a7d1b9ffa7f8bff008aa00c7f2be286c23cff000967a7faab8ffe2a9a53e2982712f844fa663b9ff1adbff84e7c26464789f45c7fd7fc5ffc5527fc277e11cffc8d1a37fe07c5ff00c55006281f14f83e6f83f27fe99dcf1fad2aafc5419dcfe0fefd12e4ff005ad9ff0084ebc258ff00919f44e7fea2117f8d723617be28f186b1ae4da1f8ced6cf4db5bcfb3db88ec22b9565f2d1890fb86796c77a00d365f8aa70449e0eff00be6e7fc69807c59033bbc1a7be0fdaaa51e1cf1f03ff00250216e3be891fff00154bff0008df8f368cf8fa0cfb68d1ff00f1740118ff0085b1dffe10dfaffa55765a6fdbce9b6ffda7f66fb76c1e7fd9b7797bfbedddce3eb5cab683e390a71e37b3e0727fb1578ffc89573e1d6b77de23f02699ab6a4c8d793ac9e6322ed076c8ca38fa01401d4d14514005145140051451400514523286186008c83cfb5002d14514005145140051451400514514005145140051451400514514005145140054377696f7d6b25addc114f6f28daf14a819587a1078353514019b1f87b458a248a3d22c5634002a8b74c003a76a77f61691bb77f65d96e3d4fd9d33fcab428a00cf3a0e8e460e95624631836e9d3f2a69f0f68a7ae8fa79e31ff1ec9fe15a54500651f0ce80c79d134d3f5b54ff000a43e17f0fb36e6d0f4c2dea6d23ff000ad6a280321bc2be1e6428da0e9857d3ec91e3f9537fe113f0e71ff120d2ff00f0123ff0ad9a280317fe10ff000cf3ff0014ee93cf5ff428ff00c293fe10ef0c0040f0ee9201ff00a728ff00c2b6fb7bd674fac5bdbebb69a4347299eea192647006c0a854104e739f9c76a00a7ff086785b183e1bd239ebfe851fff001341f05f859860f8734823d0d947fe15b946680307fe10af0b139ff846f4739f5b18cff4a3fe108f0a6dc1f0ce8d8ee3ec317ff135bd40fa6280307fe107f09e307c31a373c7fc7845ff00c4d63cbf097c152dccb38d1bca7958b3082e658941f6556007d00aed8507d4f0280387ff008547e0ece469f720e31ff1ff0071ff00c5d38fc25f06b75d3ee8f7ff00908dc7ff00175db52d007123e13f8454616cef00f6d46e3ff8bae9f46d1ac340d260d2f4c87c9b380111c7bcb632493cb124f24d5fa2800a28a2800a28a2800a28a2800a28a4c5002d145140051451400607a514514005145140051451400514514005145140051451400514514005145140051451400514514005145140066b90d4c93f14f4303671a6dd939ea06f8b91fe7d6b57c5973abd9f85b50bad0a38e4d4a088c90c7223387dbc95014e4920103df15f31cdf1b3c5736bf6fac343a70bab7824811440db76b952491bbafc83f5a00fad7b7145721f0df5ad77c43e128756d7e2b78ae2e58bc29046cb88bf849049e4f27e84575e38a00407db9a5a09f6a39ef4007f3a5a4ed4b40098f414b451400514514005145140051451400514514005145140051451400514514005145140051451400514514005145140051452647a8a005a28a2800a28cd191eb40051499146680168a28a0028a28a004ebc638a29690e0fff00ae800201183ce6be72d5be0fc937c648eca1b7dba15d1fb7bbedc2247bbe7881000ceee001d03035f4499369039c938cf6a53c9191c7bd0032de08ede08e28d0222285554e028f415373cd349f94e064f6a697c100293ef400fe7d3f0cd03207ad377719dc319eb40753ce474f5a0078a5a6e47f934a0e680168a4c51400b4514500145145001451450014514500145145001451450014514500145145001451450014514500145145007cb5f18bc49e21d3fe26ea96b67ad6a505b22c3b6286e5d117312670a0e0739fceb816f17f8a1b19f10eaff29c8ff4c9383edcd7d63af7c4af05f87b589b4cd5f54586fa10be6466da47db950c390a47420f5acc3f193e1cae71ac2649e716737ff11401f31ffc263e2a0491e23d67f0bd97ff008aa4ff0084cbc5407fc8c7ac60ff00d3ecbcfeb5f4d9f8cdf0ef77fc8613dcfd8e6e7ff1ca41f197e1de3e5d5c0e7a7d8e5ffe22803e66ff0084cbc57d0f89359e3fe9f65ff1a4ff0084d3c5679ff84975927febfa5ffe2abe993f18be1d751abc7ff8072fff00114a3e2ffc393c9d5e204f5ff4397ff88a00f99cf8d3c5781ff1526b03e97b2fff001553e9fe33f161d46dc2788b566632a80ad7d2e0f2383cf4afa4d7e2dfc38419fed883a727ec927ff1152d9fc54f877717514306ab0f9f2b044ff45906589e07ddf5a00d05d43c7a146340d149c0e7fb49ff00f8dd3db53f1d81c7877473ff007147e7e9fbaaeb72314bd2803913aa78ec0c8f0ce907dbfb59bff8d5236abe3bce078634ac63aff6b1e3ff0021575f4991401c88d57c77c7fc531a573ff5166ffe354c6d5fc799e3c2da58e39ceaa4ff00ed2aec0e3bd19c8c0c11401c43eade3cdfff00229e9eca7baeabd7ff0021d0759f1e2127fe111b07ebf77561ff00c6ebb5c8ef471d78c500715fdbde3b383ff086d9281c73ac0ffe22bc53e2d78bfc656be2ab749a7bbd0d9acd585b59ea2cc8df3bfcf950a327a74e8057d404606738ae4bc4de26f06e8fa8a5b7882eeca3ba6883aadc45bcec2481fc278c83401f287fc271e2cce4789f59cffd7f49ff00c5507c71e2c6ebe26d608ffafd93fc6be98ff84dbe173f5bed19860e73081fcd69c9e33f85c5b02f34407a64c2a3f5db401f340f1df8bc703c4facf3ff004fd27ff155f53fc24bfbcd4fe18e8f777f7535d5d4825df34d21776c4ae0649e4f00553ff84b3e174eea86f7406ec0ba4607ea2bb3d1eef4dbed26dee74792092c1d7f72d6f80980483803a739a00bd4b4514005145140051451400514514005145140051451400514514005145140051451400514514005155751bfb7d2b4dbad42edf65bdb44d2c8de8aa327f9579b7c3cf11eb31f8bf52d13c4b38373a9c2bab592efc88c30c3c23278db8002ff00b2c6803d4fa515e55f127c54da9783fc476da6e9d753d958b35a5cdf4571e56c986010141cba82c036703af07157af3e2543e19b254b9d22e1ac6c12de1b8b9f35132ce8a4794a4fef3008ce08c7d28038cf891f06fc4be2bf1d5feb5a74ba78b6b91185134ccac36c6aa72369eebea6b903fb3e78d01c799a5ffe0437ff00115ed3a87c4d9adf5cd5f4ab1f0b6a77d2e94892cee8f185f2c82c5873cfcb82abd5b2461715434ef8a4fa9788e7956d76787a1d246a1e60753205c9dcec01fe12a5768c9ce4f3c6003c85be00f8d14673a71fa4edff00c4d37fe141f8d37631a77d7ed07ff89af5e8fe34691e6babe9f2b6eb66ba83ecd710ccce8aa5995c07c238505b049c804039c03d37843c61278b2dda71a1dfe9f118629a296e546c94383f7483ce307f020f7a00f9f3fe140f8dbbae9e3eb73ffd6a4ff8507e37ed1581ff00b79ffeb57b4ea5f14d6c351d56d63f0c6af703486537af1f9788a3233bc618e78e71e99ce3145b7c59b7d4754fb1699e1dd6af862191a48625216397a3f04e060a9e707ef671b4d0078b37c03f1c6dc882c4f6c0b91fe153587c05f198d42d5a78eda287cc52f225c80cab919238ebe95eada4f8e747f0de9175710695aeca973af4969224b224d2477076e57ef938eb80376769c9e726f4bf15842faa40de16d5c5d694be75ec64c38861237062dbf0495e768c9e0fa66802d2fc3255031e32f180c7a6aa7ff89a53f0cc741e34f180e3fe82a7ff0089aa5a87c66f0f58a19a386e2e6048e296468e48958091432854670ce40619c0e33d78356ecfe275aea7e203a558683abdc849a0492e62891a3449416490e18908461b240c027383c10051f0c917a78d3c6233e9ab11ff00b2d27fc2b21ff43b78cf9ffa8a9ffe26bbca2803823f0c4e38f1b78cb3ebfdabff00d8d21f85e08e3c6be311ebff00134ffec6bbdc51401c17fc2b0381ff0015b78c33ebfda9dffef9a6ff00c2af62067c6fe30e3fea27ff00d8d77f4b401e7fff000ac1b248f1b78c31ff00613e7ff41af30f88bf073c5177e20865d1a5d435ab6fb3aa99f51bd47911b73654138f97183f526be8ec8ce33cd6078de4d621f05eab268018ea6b093084196ea376d1ddb6e71ef8eb401f317fc293f1eeedbfd8c99ffafa8bff008aa4ff008527e3ece068c84e33817717ff00155ec3e10bcd1fc4da8e9d2e91afeb514f6de626a7a5dfea1319645f2d977e0b1e4315395200cf638ae3a5d68daf87fc4971078b3538b5eb1d71e2d3ad0ea524864883a05531331debcb7507a7391c5007243e0878fcf5d1541ffafb87ff008aafa43e1ae897de1df87fa5695a945e4de408fe647b836d25d8f50483c115aba1eabf6dd3aca3bd9208f5736b1cb7568ae37c4e5416cae72064d6b500145145001451450014514605001451450014514500145145001451450014514500145145001451450072de32d1354f101d36c6de3b37d296ea39afe39e66569915b3e5ed08c0ae704e7ae31c75ac2f127c3c75d6742d5fc1ba668fa75e69d706495ffe3dc4b191864212339c8c8c93c738073c7a351401e49a97807c61fd97e23d134e97467d335ab86bb2f732ca2581dc8675185c30047078f523b566eaff000bbc63aad96a76d733e857525cf9261bb9cc9e65baaed2628fe521132bd7a9ee3278f6da2803c73471e271f123c671585b69335f3da58a5c3cd34891c6fe4705708c59739c8383d2a68be136a560c74fb0bab23a65ce8c34eba9a5dfe6abee6667451c1c96e85bf3c60fa7dbe8ba55a6a136a16da6d9c37b367cdb88e05591f3c9dcc064d5ea00f2787c1fe3a9b409f4abeff8479112ca4b68e6b60eb25c334663064628703e62c48192401c026bbcf08e9977a3784b4ad2ef8422e6ced9207f25cb21da30082403c800f4e2b6e8c500791456bae5f78cbe21d86916b60e2f0c30b4d7570d19849831bb6846dc30738e39fad6e7813c0fa8784bc45a9ccdf657d3e6b4b6b781d66632130a6dcb2ed006ee4f04e381cd76767a2695a7ddcd7765a659db5ccffeb66860547939cfcc40c9e6afd00793b7c3ff00123d82c0534d0dff000937f6d362e5f1e5e73b3fd5f5ad3baf06eb936a5e3cba02c76f882ce3b6b51e73650ac463cbfc9c75cf19e98f7af45a2803c5f43f869e2bf0cb795656be1abd82e61884c6f919cc12aa0562a76fcca719c71f8753d9f847c31aa689e2bf10ea37ad6f25bdfadb2c2e927ce7ca4d99650a1467ae0703a576b4500252d14500145145001451450018ac9f12dbeab75a0cf168734516a3ba3685a662a9c3a92188e704020fae6b5a8a00f36b8f086a5ad78c348f104fa358e9171a7b3c9712db5c0796edb6ed550428057d4b738c800569f803c317fa0a6b3fdab6f6fe65dea735ec2d1b8930af8e33804118aed4fe34b401e5f14fe16bbf8b56b069f1c16d7f6335c34d22444cb7570ea7729600e5141724b1182140e01af50a4a5a0028a28a0028a28a0028a28a0028a28a0028a28a0028a28a0028a28a0028a28a0028a28a0028a28a0028a28a0028a28a0028a28a0028a28a0028a28a0028a28a0028a28a0028a28a0028a28a0028a28a0028a28a0028a28a0028a28a004a5a28a0028a29280168a28a0028a28a0028a28a0028a28a0028a28a0028a28a0028a28a00ffd9